SecReT6
Protein ID: 110277129
SecReT6 ID788
T6SS typei1
Gene symbolvasA
Locus tag110277129
StrainAeromonas hydrophila SSU
Repliconchromosome [GenBank: DQ667172] [Browse all T6SS(s) in this replicon]
Location [Strand]6073..7839 [+]
ProductVasA
NoteTssF
UniProt IDQ0PZH0, Q0PZH0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.20E-199, Aligned region: 3..588
Protein Sequence: 588 a.a.     [Download]
>gi|110277129|ref|ABG57138.1| VasA [Aeromonas hydrophila]
MSLEHYFRDELAFLRLQGREFADAYPELTRFLSEQNTDPDVERLLEGFAFLTGNLRAKIEDEFPELTHGL
LNMLWPNYLRPVPSMTIMQFSVIPGAIAQPALVRQGCQLDSLPMDEVTCHFQTCHDTWVYPADIRHIAAQ
SGNDLSTISLDIALHAPLPLSELQLDKLRFFLGGDSYTAYELYFWLSNQLSHIELEIDGKCFRQEAKALK
PVGFERGDALLPYPNNVYSGYRILQEYFCFPESFLFFELSGGDWPKQPLPVSEFKVHFCFDRPLPAELKI
RPDSFMLNCVPAINLFQHDSEPVNLNGRQAEYPLKASYRHADGFEIFSVDQVEGWVEGNLGRSRGTPRIY
QPFESFQHQIERAKQRLALYYRVRVKEAVSGDGFEHSLSFVRGDETTTVELDESISVTLTCTNRSRAARL
KVGSVCVPTGSSPSFATFRNLIRPTRPLRPALDGSLHWTLISNLSLNYVSLLRRDALVQVLRTYDFPALH
DKQAEQASRKRLAGIEEIETKPVDRLVRGMPVRGLKSVLSIRQSAFGSEGELYLFSTVLAHFFSLYASVN
AFHLLEVVNLDNKERHQWPVQIGQHSLM
 
Nucleotide Sequence: 1767 bp     [Download]
>gi|110277122|gb|DQ667172|vasA|:6073-7839
ATGTCGCTGGAACATTACTTCAGGGATGAACTGGCATTTTTGCGCCTGCAAGGGCGTGAATTTGCCGACG
CCTATCCCGAACTCACCCGCTTTCTGTCGGAGCAGAACACCGATCCGGACGTGGAGCGCCTGCTGGAGGG
ATTCGCCTTCCTCACGGGCAACCTGCGCGCCAAGATTGAGGATGAGTTTCCCGAGCTGACCCACGGTCTG
CTCAACATGCTCTGGCCCAACTACCTGCGTCCCGTGCCCAGCATGACCATCATGCAGTTTTCGGTCATTC
CTGGGGCCATCGCCCAGCCGGCGCTGGTCAGGCAAGGCTGCCAGCTCGACAGCCTGCCCATGGACGAGGT
GACCTGCCATTTCCAGACCTGTCACGATACCTGGGTCTATCCGGCCGATATCCGCCATATTGCCGCCCAG
AGCGGCAACGATCTCTCCACCATCTCGCTCGATATCGCCCTGCATGCTCCTCTGCCGCTCAGCGAACTGC
AACTGGACAAGCTGCGCTTCTTCCTCGGTGGCGACAGCTACACCGCCTATGAGCTCTATTTCTGGCTCTC
CAACCAGCTCTCCCATATTGAGCTTGAGATCGACGGCAAGTGCTTTCGTCAGGAGGCCAAGGCCCTCAAA
CCGGTCGGCTTCGAGCGCGGTGATGCGCTCTTGCCCTATCCGAACAACGTCTATTCCGGCTACCGGATCC
TGCAGGAGTATTTCTGCTTCCCGGAAAGCTTCCTCTTCTTCGAACTCTCCGGTGGCGACTGGCCCAAACA
GCCGTTGCCGGTGAGCGAATTCAAGGTGCACTTCTGCTTCGACCGGCCGCTGCCGGCGGAGCTCAAGATC
CGTCCCGACTCCTTCATGCTCAACTGCGTGCCGGCCATCAACCTGTTCCAGCACGACAGCGAGCCGGTCA
ACCTCAACGGTCGTCAGGCGGAGTACCCCCTCAAGGCGAGCTATCGCCACGCCGACGGCTTCGAGATCTT
CTCGGTGGATCAGGTGGAAGGCTGGGTCGAGGGGAACCTCGGCCGCTCCCGCGGCACGCCGCGCATCTAT
CAGCCGTTCGAGAGCTTCCAGCACCAGATAGAGCGGGCCAAGCAGCGGCTGGCGCTCTACTACCGGGTGC
GGGTCAAGGAGGCGGTGAGCGGGGATGGTTTCGAGCACAGCCTCTCGTTCGTGCGCGGGGATGAAACCAC
CACGGTCGAACTGGATGAATCCATCTCGGTGACGCTCACCTGTACCAACCGCTCCCGCGCCGCCCGCCTC
AAGGTGGGCAGCGTCTGCGTGCCAACCGGCAGTTCACCCTCATTTGCCACTTTCCGCAACCTGATCCGGC
CGACCCGGCCGCTGCGCCCGGCGCTGGACGGCAGTCTGCACTGGACGCTGATCTCCAACCTGTCGCTCAA
CTATGTCTCCCTGTTGCGCCGCGATGCCCTGGTGCAGGTGCTGCGCACCTACGATTTTCCGGCGCTGCAC
GACAAGCAGGCAGAGCAGGCCTCGCGCAAGCGGCTGGCGGGGATCGAGGAGATCGAAACCAAACCGGTGG
ACCGGCTGGTACGCGGCATGCCGGTGCGGGGGCTCAAGTCGGTGCTTTCTATCCGCCAGTCCGCCTTTGG
CAGCGAAGGGGAGCTCTATCTGTTCAGCACCGTGCTGGCCCACTTCTTCTCGCTGTACGCCAGCGTCAAC
GCTTTCCACCTGCTTGAGGTGGTCAATCTCGACAACAAGGAGCGCCACCAGTGGCCAGTCCAGATCGGTC
AGCACTCCCTGATGTGA