SecReT6
Protein ID: 110277130
SecReT6 ID788
T6SS typei1
Gene symbol-
Locus tag110277130
StrainAeromonas hydrophila SSU
Repliconchromosome [GenBank: DQ667172] [Browse all T6SS(s) in this replicon]
Location [Strand]7803..8801 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ0PZG9, Q0PZG9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.10E-96, Aligned region: 17..319
Protein Sequence: 332 a.a.     [Download]
>gi|110277130|ref|ABG57139.1| hypothetical protein [Aeromonas hydrophila]
MASPDRSALPDVTSGKDAPRFNFFQLVELLNRLDGTDQERGLDYLPGDENIRFKATASLGFPTSDVLQIG
RDGQGRHELEVAFLGLHGSQSPMPGYYLDSLAWEYAQGEQKLGLFLDFFHHRLLTLLHRIWRKYRYHVRF
QDNGEDGFSRLMFALVGLGNEAVCQSLPVNRAKMLSYAGMLASPSRSPEVVAGLVAHCFDLADVEVSAWQ
WRKVPIHQDQQNRLGGACATLGDDFVIGDKVNDCAGKFLLKINNLSFGQFLGFLPNGEHFHALVTFVSFI
LRDQLAWDLRLGFGQEQARGLRLGEEQSARLGWSTFLGQPPSDPFVTICVQE
 
Nucleotide Sequence: 999 bp     [Download]
>gi|110277122|gb|DQ667172|:7803-8801
GTGGCCAGTCCAGATCGGTCAGCACTCCCTGATGTGACGTCCGGCAAGGACGCGCCCCGCTTCAACTTCT
TCCAGCTGGTTGAGCTGCTCAACCGGCTGGATGGTACCGATCAGGAGCGAGGGCTCGACTACCTGCCCGG
TGACGAGAACATCCGCTTCAAGGCGACCGCCTCCCTGGGGTTCCCTACCAGCGACGTGTTGCAGATTGGC
CGGGACGGACAAGGACGCCACGAGCTGGAGGTGGCCTTTCTCGGCCTGCACGGCAGCCAGTCGCCGATGC
CCGGCTATTACCTCGATTCGCTGGCGTGGGAGTACGCCCAGGGGGAGCAGAAGCTCGGCCTGTTCCTGGA
CTTCTTCCACCACCGTCTGCTGACCCTGCTGCACCGGATCTGGCGCAAGTATCGTTACCACGTCCGGTTT
CAGGACAACGGCGAGGATGGTTTCTCCCGCCTGATGTTCGCTCTGGTAGGGCTTGGCAACGAGGCGGTCT
GCCAGAGCCTGCCGGTCAACCGGGCCAAGATGCTCTCCTATGCGGGCATGCTGGCCAGCCCCAGCCGCTC
CCCCGAGGTGGTGGCCGGTCTGGTGGCCCACTGTTTCGATCTGGCGGACGTGGAGGTGAGCGCCTGGCAG
TGGCGCAAGGTGCCTATTCACCAGGATCAGCAAAACCGCCTCGGCGGTGCCTGCGCCACCCTGGGGGATG
ACTTTGTCATCGGCGACAAGGTGAACGACTGTGCCGGCAAGTTCTTGTTGAAGATCAACAACCTGAGTTT
TGGCCAGTTTCTCGGGTTTCTGCCGAACGGGGAGCACTTCCACGCCCTGGTGACCTTCGTCTCCTTCATC
CTGCGCGATCAGCTGGCCTGGGATCTGCGGCTGGGTTTCGGCCAGGAGCAGGCGAGGGGACTGAGACTCG
GTGAAGAGCAGAGTGCCCGTCTGGGGTGGAGTACCTTTCTCGGTCAGCCGCCGAGCGATCCGTTCGTGAC
CATTTGTGTGCAGGAATAA