SecReT6
Protein ID: 110277131
SecReT6 ID788
T6SS typei1
Gene symbol-
Locus tag110277131
StrainAeromonas hydrophila SSU
Repliconchromosome [GenBank: DQ667172] [Browse all T6SS(s) in this replicon]
Location [Strand]8858..10138 [+]
Producthypothetical protein
NoteFha
UniProt IDQ0PZG8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.70E-05, Aligned region: 34..101
Protein Sequence: 426 a.a.     [Download]
>gi|110277131|ref|ABG57140.1| hypothetical protein [Aeromonas hydrophila]
MDDFNQQLSLVVLNSEQLDGSQQVQYRFDEMGGTLGASEQDDWQLRDRLGAVLPAHARIELNDGRFCLCD
LSGQTYINGATSPIGRARKVHLEQGDELIVGPFRLRTYLGAITPEQSLQQVLGNRATEQLDEWLTGDEPT
ARTDDPRTLAADPLLALQQERRTPNSLMDGLPTAGVPTDGPLADSRLQASPRSQPDVDVSPLAPFSAVEN
TMNQEFLDMPSIENHPDYQLSLDGVDHVALTPLMRGLGQPLQLQDTQQAHDMLEEMGKTVRAMVEGLLQL
QTEQAALADKHLRPIEDNPLRLGLDYDETLAVLFAEQKSPVHLSAPAAVAESLHNVRIHHVANQQAIGAA
LDSILQAFSPEALIGRFEQYRRSGASGMADEGWAWNMYQHYYRELTSARQQGFDKLFHQVYAQAYDQAVR
QQQGLI
 
Nucleotide Sequence: 1281 bp     [Download]
>gi|110277122|gb|DQ667172|:8858-10138
GTGGACGATTTTAACCAGCAACTTTCCCTGGTGGTGCTCAACAGCGAACAGCTCGACGGCAGCCAGCAGG
TGCAGTACCGCTTCGACGAGATGGGGGGGACCCTGGGGGCTTCCGAGCAGGATGACTGGCAGCTGCGGGA
CAGGTTGGGGGCCGTGCTGCCCGCCCACGCCCGCATCGAGCTCAACGACGGTCGCTTCTGCCTGTGCGAT
CTGAGCGGCCAGACCTATATCAATGGCGCCACCTCACCTATCGGGCGGGCCCGCAAGGTGCATCTGGAGC
AGGGGGACGAGCTCATCGTCGGCCCGTTCCGGTTGCGTACCTACCTGGGGGCCATCACCCCCGAGCAGAG
CCTGCAGCAGGTGCTGGGCAATCGTGCCACCGAGCAGCTCGACGAGTGGCTGACCGGTGATGAACCCACC
GCCCGAACCGATGATCCGCGTACCCTAGCGGCCGATCCCCTGCTGGCACTGCAACAGGAGCGCCGGACCC
CCAATTCGTTGATGGATGGCTTGCCAACAGCTGGCGTGCCGACGGATGGCCCGCTGGCGGATAGTCGCCT
GCAGGCTTCACCGCGTTCACAGCCGGATGTGGACGTTTCCCCTCTTGCCCCCTTTTCTGCTGTCGAGAAC
ACCATGAACCAAGAATTTCTGGATATGCCCAGCATCGAGAACCACCCCGATTATCAGCTGTCGCTGGACG
GCGTCGATCACGTGGCCCTGACCCCGCTGATGCGCGGCCTGGGTCAGCCCTTGCAACTGCAGGACACCCA
ACAGGCCCACGACATGCTCGAAGAGATGGGCAAGACGGTGCGGGCCATGGTGGAGGGGTTGCTGCAGTTG
CAAACCGAACAGGCGGCGCTGGCGGACAAGCACCTGCGCCCCATCGAGGACAACCCGCTGCGCCTGGGCC
TTGACTATGACGAGACCCTGGCGGTGCTGTTTGCCGAGCAGAAGAGCCCGGTCCACCTGAGTGCGCCGGC
GGCGGTGGCCGAGAGCCTACACAATGTGCGCATCCACCACGTGGCAAACCAGCAGGCCATCGGTGCGGCG
CTGGACAGCATTCTGCAAGCCTTCTCGCCCGAGGCGCTGATCGGCCGGTTCGAACAATACCGCCGCAGTG
GCGCGTCGGGCATGGCCGATGAAGGTTGGGCCTGGAACATGTACCAGCACTACTACCGCGAGCTCACCTC
CGCCCGCCAGCAGGGGTTCGACAAGCTGTTCCACCAGGTGTATGCCCAGGCCTATGACCAGGCCGTGCGT
CAGCAACAGGGACTGATTTGA