SecReT6
Protein ID: 110277132
SecReT6 ID788
T6SS typei1
Gene symbol-
Locus tag110277132
StrainAeromonas hydrophila SSU
Repliconchromosome [GenBank: DQ667172] [Browse all T6SS(s) in this replicon]
Location [Strand]10138..10653 [+]
Producthypothetical protein
NoteTssJ
UniProt IDQ0PZG7, Q0PZG7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.60E-40, Aligned region: 11..162
Protein Sequence: 171 a.a.     [Download]
>gi|110277132|ref|ABG57141.1| hypothetical protein [Aeromonas hydrophila]
MIRALMLGAALLALAGCTTMGKMADVAMNPDIQVGSNDSQPSTLGLSLLAEPDVNPNESGEAAPIEFQVV
LLAEDSKLLATDYDQVTADVEKALGKNYLDHQDYTLLPGQFKYLPPVKLDEKTRYIGVIARYADPDSAEW
RKVIKIKSKGAAYQILVHLRLDEVELQKEEE
 
Nucleotide Sequence: 516 bp     [Download]
>gi|110277122|gb|DQ667172|:10138-10653
ATGATACGTGCGCTGATGCTGGGGGCGGCTCTGCTGGCCCTGGCTGGCTGTACCACCATGGGCAAGATGG
CCGACGTCGCCATGAACCCGGATATCCAGGTGGGCAGCAATGACAGTCAACCCTCCACCCTGGGGCTGAG
CCTGTTGGCTGAGCCTGACGTCAACCCCAACGAGAGCGGGGAGGCGGCGCCCATCGAGTTTCAGGTGGTG
CTGCTGGCCGAGGATTCCAAGCTGCTCGCCACCGACTACGACCAGGTGACGGCAGATGTCGAGAAGGCCC
TTGGCAAGAACTACCTTGACCATCAGGACTACACCCTGCTGCCGGGCCAGTTCAAATACCTGCCCCCTGT
CAAGCTCGACGAGAAGACCCGTTACATCGGCGTGATCGCACGCTACGCCGACCCGGACAGCGCCGAGTGG
CGCAAGGTCATCAAGATCAAGAGCAAGGGCGCGGCTTATCAAATCCTGGTGCACCTGCGCCTGGATGAAG
TGGAACTGCAAAAAGAAGAAGAATAA