SecReT6
Protein ID: 110277133
SecReT6 ID788
T6SS typei1
Gene symbol-
Locus tag110277133
StrainAeromonas hydrophila SSU
Repliconchromosome [GenBank: DQ667172] [Browse all T6SS(s) in this replicon]
Location [Strand]10656..11990 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ0PZG6, Q0PZG6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.90E-161, Aligned region: 19..442
Protein Sequence: 444 a.a.     [Download]
>gi|110277133|ref|ABG57142.1| hypothetical protein [Aeromonas hydrophila]
MSSRNRVIWREGLFIKPQHFQQQQRHSDYALHARLSALSDYFYGLQSLAINEDYLGFGRIALVGATGILP
DGTVFNIPNDDMLPTPLEITDASVANQKVYLALPLSVSGVNEVGQGGQVATRLQAHRHDVRDLHSEGGDV
VSLEVGRVSLRLMLEREDRSAYASLAIARILDKRPDGGLVLDPNFMPCSISVSAIPTLKRFLGESAGLVA
ERARSLSQRIAAPGQQGVADVAEFMMLQLLNRAQPQLSHLARLGTLHPERLHEALVQLCGELMTFTDESR
LPPEFPAYRHDDQQVSFEPVMLALRQALSTVLSPRAVSIQLRKHQYGIMVAMVNESELMKSADFVLAVRA
RMPQEQLRKQLLQQTKVASSDKIRELISLQLPGIPLLPLPVAPRQLPYHAGYSYFQLDRQSPAWQMLAVS
NTLAFHIAGDFPELDMQLWAIRSQ
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|110277122|gb|DQ667172|:10656-11990
ATGTCGAGTCGAAATCGGGTTATCTGGCGTGAGGGGCTGTTCATCAAGCCCCAGCACTTCCAGCAACAAC
AAAGGCATTCGGATTACGCGCTGCACGCTCGCCTGAGCGCGCTGTCCGACTATTTCTATGGCTTGCAGTC
GCTCGCCATCAACGAGGATTACCTCGGCTTTGGCCGCATCGCCCTGGTGGGAGCTACCGGCATCCTGCCG
GACGGGACCGTGTTCAACATCCCCAACGACGACATGCTGCCGACCCCACTGGAGATCACCGATGCCTCGG
TGGCCAACCAGAAGGTCTATCTGGCGCTGCCGCTCTCGGTAAGCGGCGTCAACGAGGTGGGGCAGGGCGG
CCAGGTGGCTACCCGGCTGCAGGCCCATCGCCACGATGTGCGCGACCTGCACAGCGAAGGGGGGGATGTG
GTCTCCCTCGAAGTGGGGCGGGTCAGCCTGCGGCTGATGCTGGAGCGTGAAGATCGCAGCGCCTACGCGT
CGCTCGCTATTGCCCGCATTCTGGACAAGCGTCCGGACGGCGGTCTGGTGCTGGATCCCAATTTCATGCC
CTGCAGTATCAGCGTCTCCGCCATCCCGACCCTCAAGCGCTTCCTCGGCGAGTCGGCCGGCCTCGTGGCC
GAGCGGGCCCGCAGCCTCTCCCAGCGCATTGCGGCGCCCGGTCAGCAAGGGGTGGCCGACGTGGCCGAGT
TCATGATGTTGCAGCTGCTGAACCGGGCTCAGCCCCAGCTCTCTCATCTGGCGCGCCTGGGTACCCTGCA
CCCGGAGCGGCTGCACGAGGCGCTGGTCCAGCTCTGTGGCGAGCTGATGACCTTCACCGACGAGTCCCGC
CTGCCGCCGGAGTTCCCCGCCTATCGTCACGACGATCAGCAGGTGAGCTTCGAACCGGTGATGCTGGCAC
TGCGCCAAGCGCTCAGTACCGTGCTGTCGCCGCGCGCCGTCTCCATCCAGCTGCGCAAGCACCAGTACGG
CATCATGGTGGCCATGGTGAACGAGAGCGAGCTGATGAAAAGCGCCGACTTCGTGCTGGCGGTGCGCGCC
CGCATGCCGCAGGAGCAGTTGCGCAAGCAACTGCTGCAGCAGACCAAGGTGGCCTCCAGCGACAAGATCC
GCGAGCTCATCAGCCTGCAACTGCCCGGCATTCCGTTGCTGCCGCTGCCGGTGGCGCCGCGCCAGCTGCC
CTATCACGCCGGTTACAGCTACTTCCAGCTCGACCGGCAGAGCCCGGCCTGGCAGATGCTGGCGGTCAGC
AACACCCTTGCCTTCCATATCGCCGGCGACTTCCCCGAGCTCGACATGCAGCTCTGGGCCATTCGCAGCC
AGTGA