SecReT6
Protein ID: 110277134
SecReT6 ID788
T6SS typei1
Gene symbolvasF
Locus tag110277134
StrainAeromonas hydrophila SSU
Repliconchromosome [GenBank: DQ667172] [Browse all T6SS(s) in this replicon]
Location [Strand]12082..12792 [+]
ProductVasF
NoteTssL
UniProt IDQ0PZG5, Q0PZG5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.20E-69, Aligned region: 15..220
Protein Sequence: 236 a.a.     [Download]
>gi|110277134|ref|ABG57143.1| VasF [Aeromonas hydrophila]
MDSDYWFRLRGQSINPMIDAVTPLLGLVQRVRLLSRYDQVPELYQRVVTEIQAIEQELMAQGYENGVVLS
FRYILCTFIDEAVMGRDWGSQSEWSQHSLLARFHNETWGGEKVFVLLARLQEDPVRYRDILEFIYLCLCL
GFEGRYKVMSQGREEFERIVRQLHKQLAHEAGGEAPSVFHLDLGQQASRYQLRKQVSLRSLFMGGALILA
LIFGLYHHQLNNQTQDVLRQLGELLK
 
Nucleotide Sequence: 711 bp     [Download]
>gi|110277122|gb|DQ667172|vasF|:12082-12792
ATGGATTCGGACTACTGGTTCCGCCTGCGCGGCCAGAGCATCAACCCGATGATCGACGCGGTGACCCCCT
TGCTGGGGCTGGTGCAGCGGGTGCGCCTGCTGTCGCGCTATGACCAGGTGCCCGAGCTCTACCAGCGGGT
GGTGACCGAGATCCAGGCCATCGAACAGGAGCTGATGGCCCAGGGTTACGAGAACGGGGTGGTGCTGTCG
TTTCGCTACATCCTCTGCACCTTCATCGACGAGGCCGTGATGGGGCGCGACTGGGGCAGCCAGAGCGAGT
GGTCCCAGCACTCCCTGCTGGCCCGCTTCCACAACGAGACCTGGGGCGGCGAGAAGGTGTTCGTGCTGCT
GGCGCGCCTGCAGGAAGACCCGGTGCGCTACCGCGACATTCTGGAGTTCATCTACCTGTGCCTCTGCCTC
GGTTTCGAGGGGCGCTACAAGGTGATGAGCCAGGGGCGGGAAGAGTTCGAGCGCATCGTGCGCCAGCTGC
ACAAGCAGTTGGCGCACGAGGCAGGTGGTGAGGCTCCCAGCGTGTTTCACCTCGATCTGGGGCAGCAGGC
CTCCCGCTATCAGCTGCGCAAGCAGGTTTCCCTGCGCAGTCTGTTCATGGGCGGGGCGCTGATCCTGGCG
CTGATCTTCGGCCTCTACCACCACCAACTCAATAACCAGACCCAGGACGTACTGCGTCAACTGGGCGAAT
TATTAAAATAA