SecReT6
Protein ID: 110277135
SecReT6 ID788
T6SS typei1
Gene symbolclpB
Locus tag110277135
StrainAeromonas hydrophila SSU
Repliconchromosome [GenBank: DQ667172] [Browse all T6SS(s) in this replicon]
Location [Strand]12813..15455 [+]
ProductClpB protein
NoteTssH
UniProt IDQ0PZG4, Q0PZG4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.50E-38, Aligned region: 222..320
AAA_2 [PF07724], Evalue: 3.50E-38, Aligned region: 617..778
AAA [PF00004], Evalue: 2.70E-18, Aligned region: 222..321
AAA [PF00004], Evalue: 2.70E-18, Aligned region: 554..578
AAA [PF00004], Evalue: 2.70E-18, Aligned region: 623..741
AAA_5 [PF07728], Evalue: 3.70E-14, Aligned region: 222..246
AAA_5 [PF07728], Evalue: 3.70E-14, Aligned region: 622..740
ClpB_D2-small [PF10431], Evalue: 2.30E-13, Aligned region: 784..858
AAA_16 [PF13191], Evalue: 5.30E-10, Aligned region: 199..237
AAA_16 [PF13191], Evalue: 5.30E-10, Aligned region: 265..300
AAA_16 [PF13191], Evalue: 5.30E-10, Aligned region: 593..660
AAA_16 [PF13191], Evalue: 5.30E-10, Aligned region: 688..716
AAA_22 [PF13401], Evalue: 4.50E-07, Aligned region: 221..307
AAA_22 [PF13401], Evalue: 4.50E-07, Aligned region: 454..463
AAA_22 [PF13401], Evalue: 4.50E-07, Aligned region: 621..641
AAA_22 [PF13401], Evalue: 4.50E-07, Aligned region: 684..716
Arch_ATPase [PF01637], Evalue: 7.20E-05, Aligned region: 202..236
Arch_ATPase [PF01637], Evalue: 7.20E-05, Aligned region: 275..358
Arch_ATPase [PF01637], Evalue: 7.20E-05, Aligned region: 623..658
Arch_ATPase [PF01637], Evalue: 7.20E-05, Aligned region: 693..704
DUF258 [PF03193], Evalue: 7.40E-05, Aligned region: 189..240
DUF258 [PF03193], Evalue: 7.40E-05, Aligned region: 623..640
NACHT [PF05729], Evalue: 9.10E-05, Aligned region: 222..250
NACHT [PF05729], Evalue: 9.10E-05, Aligned region: 415..451
NACHT [PF05729], Evalue: 9.10E-05, Aligned region: 483..522
NACHT [PF05729], Evalue: 9.10E-05, Aligned region: 623..649
NACHT [PF05729], Evalue: 9.10E-05, Aligned region: 829..860
AAA_29 [PF13555], Evalue: 0.00013, Aligned region: 217..245
AAA_29 [PF13555], Evalue: 0.00013, Aligned region: 620..644
AAA_10 [PF12846], Evalue: 0.00013, Aligned region: 220..244
AAA_10 [PF12846], Evalue: 0.00013, Aligned region: 284..308
AAA_10 [PF12846], Evalue: 0.00013, Aligned region: 352..457
AAA_10 [PF12846], Evalue: 0.00013, Aligned region: 622..742
AAA_25 [PF13481], Evalue: 0.00065, Aligned region: 222..246
AAA_25 [PF13481], Evalue: 0.00065, Aligned region: 275..308
AAA_25 [PF13481], Evalue: 0.00065, Aligned region: 503..545
AAA_25 [PF13481], Evalue: 0.00065, Aligned region: 616..651
AAA_14 [PF13173], Evalue: 0.0007, Aligned region: 222..304
AAA_14 [PF13173], Evalue: 0.0007, Aligned region: 622..711
AAA_19 [PF13245], Evalue: 0.0011, Aligned region: 219..243
AAA_19 [PF13245], Evalue: 0.0011, Aligned region: 359..384
AAA_19 [PF13245], Evalue: 0.0011, Aligned region: 553..564
AAA_19 [PF13245], Evalue: 0.0011, Aligned region: 614..641
Zeta_toxin [PF06414], Evalue: 0.0013, Aligned region: 219..243
Zeta_toxin [PF06414], Evalue: 0.0013, Aligned region: 418..443
Zeta_toxin [PF06414], Evalue: 0.0013, Aligned region: 621..662
Clp_N [PF02861], Evalue: 0.0024, Aligned region: 29..71
Clp_N [PF02861], Evalue: 0.0024, Aligned region: 105..125
IstB_IS21 [PF01695], Evalue: 0.003, Aligned region: 216..244
IstB_IS21 [PF01695], Evalue: 0.003, Aligned region: 622..633
AAA_17 [PF13207], Evalue: 0.0032, Aligned region: 222..292
AAA_17 [PF13207], Evalue: 0.0032, Aligned region: 623..657
AAA_17 [PF13207], Evalue: 0.0032, Aligned region: 800..821
Sigma54_activat [PF00158], Evalue: 0.0033, Aligned region: 220..236
Sigma54_activat [PF00158], Evalue: 0.0033, Aligned region: 622..720
MobB [PF03205], Evalue: 0.0037, Aligned region: 133..193
MobB [PF03205], Evalue: 0.0037, Aligned region: 222..243
MobB [PF03205], Evalue: 0.0037, Aligned region: 622..642
Ras [PF00071], Evalue: 0.0059, Aligned region: 222..235
Ras [PF00071], Evalue: 0.0059, Aligned region: 623..664
Protein Sequence: 880 a.a.     [Download]
>gi|110277135|ref|ABG57144.1| ClpB protein [Aeromonas hydrophila]
MIRIELPVLVERLNPICRHMLEEAAALCVNHQGAEIRIEHLLLKMLETPLSDVRQILKVAEVDVEELKAL
LQPSPADNGYGQGYPSFSPMLVEWLQDSWLLASAELQHAQLRSGVMLLVLLMTPQRYLPGSVTRLLAKVN
RELLRQQFDEWVKESAETQVTTTPGGKTAQAALPADASLLARFTVNVTEQARQGSLDPVLCRDHEIDLMI
DILSRRRKNNPIVVGEAGVGKSALIEGLALRMVAGQVPEKLRGVELMTLDLGAMQAGASVKGEFEKRFKG
VMQEVKDAVQPVILFIDEAHTLIGAGNQAGGLDVSNLIKPALARGELRTIAATTWGEYKKYVEKDAALSR
RFQLVKVGEPDADEATVILRGLRSIYEKAHGVLIDEEALQASAQLSARYISGRQLPDKAIDVLDTACARV
AINLTTPPRAVSHLQNALRQRELEIRQLERQSLIGLGDNAERLAELQTAQQACREELAEQEARWQQQQGL
VHQIVELRAALLADQQDEMLAREALDLADAPLDPQAAAEQLATLERELAELQQGEVLVSAHVDKTQIAAV
IAEWTGVPLNRISQGELDVVTRLPEYLGELIKGQDVAVAHLHKHLLTARADLRRPGRPLGAFLLVGPSGV
GKTETVLQIAELMFGGRQYLTTINMSEYQEKHTVSRLIGSPPGYVGFGEGGVLTEAIRQKPYSVVLLDEV
EKAHPDVLNLFYQAFDKGELADGEGRIIDCKNVVFFLTSNLGFQTIVDHAEQPDVLLDALYPELAAFFKP
ALLARMEVIPYLPLGHDTLVQIVGGKLNRLVKLLKERFGAEVVLDDEVAEEILLRANRSENGARMLESVI
DGALLPPVSLQLLQRLSAGEPIKRVHFSVADHQFVAEVGA
 
Nucleotide Sequence: 2643 bp     [Download]
>gi|110277122|gb|DQ667172|clpB|:12813-15455
TTGATTCGTATAGAGCTACCGGTACTGGTGGAAAGACTCAACCCCATCTGCCGTCACATGCTGGAGGAGG
CCGCGGCCCTCTGTGTCAATCACCAGGGGGCCGAGATCCGCATCGAGCACCTGCTGCTCAAGATGCTGGA
GACCCCGCTGAGCGACGTGCGCCAGATCCTGAAGGTGGCCGAGGTCGACGTTGAAGAGCTGAAGGCCCTG
CTGCAACCCTCGCCAGCTGACAACGGTTATGGCCAGGGTTACCCCTCCTTCTCGCCCATGCTGGTGGAGT
GGCTGCAAGACAGCTGGCTGCTCGCCTCCGCCGAGCTGCAACACGCCCAGCTGCGCAGCGGTGTCATGCT
GCTGGTGCTGCTGATGACCCCCCAGCGCTATCTGCCGGGCTCGGTGACCCGCCTGCTTGCCAAGGTCAAT
CGCGAGCTGCTGCGCCAGCAGTTTGACGAGTGGGTCAAGGAGTCTGCCGAGACACAAGTGACCACAACCC
CCGGTGGCAAGACGGCTCAGGCCGCGCTGCCGGCCGATGCCAGCCTGCTGGCCCGCTTCACCGTCAATGT
GACCGAACAGGCCCGCCAGGGCAGCCTGGATCCCGTGCTCTGCCGGGATCACGAGATCGACCTGATGATC
GACATCCTCTCCCGTCGTCGCAAGAACAACCCCATAGTCGTGGGGGAGGCTGGTGTCGGCAAGAGCGCCC
TCATCGAGGGGCTGGCTCTGCGCATGGTGGCGGGCCAGGTGCCCGAGAAGCTGCGCGGGGTCGAGCTGAT
GACGCTGGATCTCGGTGCCATGCAGGCCGGCGCTTCGGTCAAGGGGGAGTTCGAGAAACGCTTTAAGGGG
GTGATGCAGGAGGTCAAGGACGCCGTGCAACCGGTCATCCTCTTCATCGACGAGGCGCACACCCTGATCG
GGGCCGGCAACCAGGCCGGCGGGCTGGATGTCTCCAACCTCATCAAGCCGGCGCTGGCCCGGGGCGAGCT
GCGCACCATCGCCGCCACCACCTGGGGCGAGTACAAGAAATACGTTGAAAAAGACGCGGCCCTGTCGCGC
CGCTTCCAGCTGGTGAAAGTCGGTGAGCCCGATGCCGACGAGGCCACCGTGATCCTGCGCGGCCTGCGCA
GCATCTACGAGAAGGCCCACGGGGTGCTGATCGACGAGGAGGCGCTGCAGGCCTCCGCCCAGCTCTCCGC
CCGCTATATCTCCGGCCGTCAGTTGCCGGACAAGGCGATCGACGTGCTCGACACCGCCTGTGCCCGGGTG
GCCATCAATCTCACCACGCCGCCGCGCGCGGTCAGCCACCTGCAAAACGCGCTGCGCCAGCGCGAGCTGG
AGATCCGCCAGCTGGAGCGCCAGAGCCTGATCGGCCTCGGTGACAACGCAGAGCGCCTGGCAGAGTTGCA
GACGGCCCAGCAGGCTTGCCGCGAAGAGCTGGCCGAGCAGGAGGCCCGCTGGCAGCAGCAGCAGGGGCTG
GTACACCAGATTGTCGAGCTGCGCGCCGCCCTGCTGGCCGATCAGCAGGATGAGATGCTGGCCAGAGAGG
CGCTGGATCTCGCCGATGCGCCCCTCGATCCGCAAGCCGCTGCCGAGCAGCTGGCCACCCTCGAGCGCGA
GCTGGCCGAGCTGCAGCAAGGAGAAGTGCTGGTCTCCGCCCACGTCGACAAGACCCAGATTGCTGCCGTC
ATCGCCGAGTGGACCGGGGTGCCCCTCAATCGCATCTCGCAAGGGGAGCTGGACGTGGTGACCCGATTGC
CGGAGTACCTCGGCGAGCTTATCAAGGGGCAGGATGTGGCGGTGGCCCACCTGCACAAGCACCTGCTGAC
CGCCCGCGCCGATTTGCGTCGTCCCGGCCGCCCGCTCGGCGCCTTCCTGCTGGTAGGGCCGAGCGGCGTC
GGCAAGACCGAAACCGTGCTGCAGATTGCCGAGCTGATGTTCGGTGGTCGCCAGTATCTGACCACCATCA
ACATGTCCGAGTATCAAGAGAAGCACACCGTTTCCCGTCTCATCGGCTCGCCGCCCGGCTACGTCGGTTT
CGGCGAGGGGGGCGTGCTGACCGAGGCCATTCGGCAGAAACCTTATTCCGTGGTGCTGCTGGACGAGGTG
GAGAAGGCCCACCCGGACGTGCTCAACCTCTTCTATCAGGCGTTCGACAAGGGCGAGCTGGCGGATGGGG
AAGGGCGCATCATCGACTGCAAGAACGTGGTTTTCTTCCTCACCTCCAACCTCGGTTTCCAGACCATAGT
CGATCACGCCGAGCAGCCAGACGTGCTGCTGGATGCTCTCTATCCGGAGCTCGCCGCCTTCTTCAAGCCG
GCGCTGCTGGCACGGATGGAGGTGATCCCCTACCTGCCGCTCGGTCACGACACCCTGGTGCAGATCGTCG
GCGGCAAGCTCAACCGGCTGGTCAAGCTGCTCAAGGAGCGTTTCGGTGCCGAGGTGGTGCTGGACGACGA
GGTGGCCGAGGAGATCCTGCTGCGGGCCAATCGCAGCGAGAACGGCGCCCGCATGCTGGAATCCGTCATC
GATGGGGCCCTGCTGCCGCCGGTCTCCCTGCAACTGCTGCAACGCCTCTCGGCCGGTGAACCCATCAAGC
GCGTCCACTTTTCCGTGGCCGATCACCAGTTCGTGGCCGAGGTGGGGGCTTGA