SecReT6
Protein ID: 110277138
SecReT6 ID788
T6SS typei1
Gene symbol-
Locus tag110277138
StrainAeromonas hydrophila SSU
Repliconchromosome [GenBank: DQ667172] [Browse all T6SS(s) in this replicon]
Location [Strand]17610..19055 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ0PZG1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.30E-14, Aligned region: 50..108
ImpA-rel_N [PF06812], Evalue: 3.30E-14, Aligned region: 397..416
Protein Sequence: 481 a.a.     [Download]
>gi|110277138|ref|ABG57147.1| hypothetical protein [Aeromonas hydrophila]
MSYQHPWCARLLTSLPDEQIRGAVLADEPRWDYVETELVKLGSLAHSQVDLNAVAEACLGLLESRTKDMR
VLAQLLRCLQHPAKATPLGAAISLLEAWIQAYWLLAWPGNASQKQRLMVQIVKRFEGALPRICESASAAE
LAQLLAQAEQLEQVWLAQCPDKGELLDPLVMGLKRAQRQQVAQAQADAAGQPQSSSAAATGSPASVASTA
SGAGAMVLSGGGGSAGIDVDSSNDRAWRQTQLKVAELLIERQPEAAVGYRLRRHAVWAGITAVPMSGAGN
KTPLAPMSADMVDEYRAAMNAPDQGLWQRIEQSLTLAPYWFEGHRLSAEVAQKLGFGAVAQAIAEELGTF
LQRLPALRELAFSDGSPFLSPECSRWLQPAKGGSAGSGETGLAEEVAQRHGEQGVAAALALLDERIAQLK
EPRDRFHALLVQAELLAQEGMEALARQHYQHLWQEASRLGLSHWEPGLVNRLESLAAPLSK
 
Nucleotide Sequence: 1446 bp     [Download]
>gi|110277122|gb|DQ667172|:17610-19055
ATGAGCTATCAACACCCCTGGTGTGCACGCCTGCTCACCAGCCTGCCGGATGAACAGATCAGAGGCGCGG
TGCTGGCCGATGAGCCGCGCTGGGACTATGTGGAGACCGAGCTGGTCAAGCTGGGCTCCCTCGCTCACAG
CCAGGTCGATCTCAATGCGGTGGCCGAGGCCTGCCTCGGGTTGCTGGAGAGCCGTACCAAGGACATGCGG
GTGCTGGCCCAGCTGCTGCGCTGCCTGCAGCACCCAGCCAAGGCAACCCCGCTGGGGGCGGCGATCAGCC
TGCTGGAGGCCTGGATCCAGGCCTACTGGCTGTTGGCCTGGCCCGGCAATGCCAGCCAGAAACAGCGGCT
GATGGTGCAAATCGTCAAGCGCTTCGAAGGGGCACTGCCGCGTATTTGCGAGAGCGCTTCGGCAGCCGAG
CTGGCCCAGTTGCTGGCCCAGGCCGAGCAGCTGGAGCAGGTCTGGCTGGCGCAGTGTCCCGACAAGGGAG
AGCTGCTCGACCCGTTGGTGATGGGGCTGAAACGGGCCCAGCGCCAGCAGGTGGCTCAGGCGCAGGCTGA
TGCTGCTGGGCAGCCCCAGAGCAGCAGCGCGGCGGCAACGGGCTCCCCGGCCTCGGTGGCATCGACCGCC
AGCGGTGCCGGCGCCATGGTACTCAGCGGTGGTGGCGGCAGTGCCGGCATCGATGTCGACAGCTCCAACG
ATCGCGCCTGGCGCCAGACTCAGCTCAAGGTGGCGGAGCTCCTGATCGAGCGCCAGCCGGAGGCGGCAGT
GGGCTATCGGCTGCGCCGTCATGCCGTCTGGGCCGGGATCACGGCGGTTCCCATGAGCGGGGCGGGCAAT
AAAACCCCGCTGGCGCCCATGTCGGCGGACATGGTGGATGAGTACCGCGCCGCCATGAACGCCCCTGATC
AGGGGCTCTGGCAGCGCATCGAGCAGAGCCTGACCCTGGCGCCTTACTGGTTCGAGGGGCACAGGCTCTC
GGCCGAGGTGGCCCAGAAACTCGGCTTTGGAGCGGTGGCCCAGGCGATCGCCGAGGAGCTCGGGACTTTT
CTGCAGCGCCTGCCGGCCCTGCGGGAGCTCGCCTTCAGCGACGGCTCGCCGTTTCTCTCCCCCGAGTGCA
GCCGCTGGCTGCAACCGGCCAAGGGCGGCAGTGCCGGCAGTGGCGAAACAGGGCTGGCCGAGGAGGTCGC
CCAGCGCCATGGCGAGCAGGGGGTCGCGGCGGCGCTCGCCCTGCTCGATGAGCGGATTGCGCAGTTGAAA
GAGCCAAGAGATCGTTTCCACGCCTTGCTGGTGCAGGCGGAGCTGTTGGCGCAGGAAGGCATGGAGGCGC
TTGCGCGCCAGCACTATCAACACTTGTGGCAAGAGGCCAGTCGCCTCGGGTTGTCGCACTGGGAGCCCGG
GCTGGTCAACCGCCTGGAGAGCCTGGCGGCGCCGTTGTCGAAATGA