SecReT6
Protein ID: 110277140
SecReT6 ID788
T6SS typei1
Gene symbol-
Locus tag110277140
StrainAeromonas hydrophila SSU
Repliconchromosome [GenBank: DQ667172] [Browse all T6SS(s) in this replicon]
Location [Strand]22629..24059 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ0PZF9, Q0PZF9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 4.10E-41, Aligned region: 324..471
ImpA-rel_N [PF06812], Evalue: 7.00E-19, Aligned region: 42..101
Protein Sequence: 476 a.a.     [Download]
>gi|110277140|ref|ABG57149.1| hypothetical protein [Aeromonas hydrophila]
MSQNQQGQQALKVGRDPRMLPEYEALRAEINKLSHASRPEVDWQRIHQLASLIFEKHGADLQTAIYFTLA
RSRLQGLSGFTEGCEFLANLIVTQWESFWPPVHQERARIEMLDWFIARISDVIRQYQISHEDKRLIYRCE
RALQLISEKLHNADLSRIPRVENLVHFIEGYTHLFDETEIVIVSDEPGLKEDLQIPPMVFFKSDMESDHG
GTVSASTPHLPQGSILVGREKGQVKPTVLKIEQHRRQRPAWFWFGCGLLSCALPVMGWLGWQQHQQEKTV
AAQRLVQPAAELPRALSYDDIRQARIVLGEQTLQNMESDLVARYQNQLTRLEQTSPLYWYRYGEGLRNSL
QMLYPDSLAVKALDKQWQTQLGSQQGDVISVPTYLDARAGVDALLDQLLELERQRKTVTISYLKSQLYEV
QKNLMQNIPFSLRLDELEARKASQEPITAAELKSLENDLKALNIRLYQLQQGASGS
 
Nucleotide Sequence: 1431 bp     [Download]
>gi|110277122|gb|DQ667172|:22629-24059
ATGTCACAGAATCAACAAGGTCAGCAGGCCCTGAAAGTGGGGCGCGACCCCAGGATGTTGCCGGAGTACG
AGGCGCTGCGGGCCGAGATCAACAAGCTCAGCCACGCTTCGCGCCCCGAGGTAGACTGGCAGCGGATCCA
TCAGCTCGCCAGCCTCATCTTCGAAAAACACGGGGCGGATCTGCAGACCGCCATCTACTTCACCCTGGCC
CGTTCGCGCCTGCAGGGGCTGAGCGGTTTTACCGAAGGGTGCGAGTTTCTCGCCAACCTCATCGTCACCC
AGTGGGAGAGCTTCTGGCCGCCGGTCCATCAGGAACGAGCCCGTATCGAGATGCTCGACTGGTTCATCGC
CCGCATCAGCGACGTCATTCGCCAGTACCAGATCAGCCACGAGGACAAGCGGCTGATCTATCGCTGCGAG
CGGGCGCTGCAGCTCATCAGCGAGAAGCTGCACAACGCGGATCTGAGCCGCATTCCCCGGGTCGAGAATC
TGGTGCACTTCATCGAGGGGTATACCCACCTGTTCGATGAGACCGAGATCGTCATCGTCTCCGACGAGCC
GGGCCTCAAGGAGGATCTGCAGATCCCGCCCATGGTGTTCTTCAAGTCCGACATGGAGAGTGATCACGGC
GGCACGGTTTCGGCATCGACCCCGCACCTGCCCCAGGGCAGCATTCTGGTGGGGCGCGAGAAGGGGCAGG
TCAAGCCCACCGTGCTGAAGATTGAGCAGCACCGCCGGCAGCGTCCCGCCTGGTTCTGGTTTGGCTGCGG
CCTGCTCAGCTGCGCCCTGCCGGTGATGGGGTGGCTCGGCTGGCAGCAACATCAGCAGGAGAAAACCGTG
GCGGCCCAGCGCCTGGTACAGCCGGCCGCCGAGCTGCCCCGAGCCCTCAGCTACGACGACATTCGCCAGG
CACGCATCGTGCTGGGGGAGCAAACTCTGCAGAACATGGAGAGCGATCTGGTGGCCCGCTACCAGAACCA
GTTGACCCGGCTCGAGCAGACGTCGCCGCTCTACTGGTATCGCTACGGCGAGGGACTGCGGAACTCGTTA
CAGATGCTCTATCCCGACTCGCTGGCGGTCAAGGCGCTGGACAAGCAGTGGCAGACGCAGCTTGGCAGTC
AGCAGGGGGATGTCATCAGCGTGCCCACCTATCTGGATGCCCGCGCCGGGGTGGATGCCCTGCTTGATCA
GCTGCTGGAGCTGGAGCGCCAGCGCAAGACGGTGACCATTTCCTACCTCAAATCCCAGCTCTACGAAGTG
CAGAAGAACCTGATGCAGAACATCCCGTTCAGTCTGCGCCTGGATGAACTGGAGGCGAGAAAAGCCTCTC
AGGAGCCCATCACGGCAGCGGAGCTCAAGAGCCTGGAAAATGATCTGAAAGCGCTCAACATCCGCCTCTA
TCAGCTGCAACAGGGCGCTTCTGGTAGCTGA