SecReT6
Protein ID: 110277142
SecReT6 ID788
T6SS typei1
Gene symbolvgrG3
Locus tag110277142
StrainAeromonas hydrophila SSU
Repliconchromosome [GenBank: DQ667172] [Browse all T6SS(s) in this replicon]
Location [Strand]24615..26663 [+]
ProductVgrG-3 protein
NoteTssI
UniProt IDQ0PZF7, Q0PZF7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.80E-69, Aligned region: 30..325
Phage_GPD [PF05954], Evalue: 2.80E-69, Aligned region: 551..585
Phage_base_V [PF04717], Evalue: 1.70E-23, Aligned region: 372..465
DUF2345 [PF10106], Evalue: 0.0017, Aligned region: 570..620
Protein Sequence: 682 a.a.     [Download]
>gi|110277142|ref|ABG57151.1| VgrG-3 protein [Aeromonas hydrophila]
MADSTGLQFTVKVGALPESTFVVAEFALDEGLNRPFNLRLELASRQPDIDFGAVLDQPCELLVWYNGELQ
RRVCGVVSDMAQGDSGFRRTRYQLLVLPALWRLSLRQNSRIFQAQKPDEILSILLQEHGITDYAFALKNE
HAKREYCVQYRETDLDFVNRLAAEEGMFYFHEFEAGKHRIVFADDAAALTQGPELFFNLGNRSLEQGPYV
RQFHYREAVRPSDVELKDYSFKTPAYGLSHKKQGADLDHQRDTYQHFDFPGRYKQGGSGKAFAQHRLDAL
RNDAVAGSGKSNCAALQPGQTFSLTEHPNGGLNTDWQVVRIQHTGLQPQALEEEGGSGPTVYHNEFGVVK
ASSTWRARIGSPEALHKPMVDGPQIAMVVGPEGEEIYCDEHGRVKLQFPWDRYGSSNDQSSCWVRVSQGW
AGGQYGMMAIPRIGHEVIVSFLEGDPDQPIVTGRTYHATNRPPYELPANKARTVLRTETHQGEGFNELRF
EDQAGQEEIYIHGQKDLNVLIENNAVWHIKHDEHRDIDNERVTRIKANDHLTVEGEKRDQIKADYSLTVD
ASLHQKLGQSLLVEAGQEVHIKVGDKLVLEAGSEITLKGGGSFVKVDPSGIKLMGPAIKLNAGGSAGSGS
GWGGKAPVVPKGVEVVKAPELVELVKAIPTEKAMEALLKEQGPAQTFFVPSR
 
Nucleotide Sequence: 2049 bp     [Download]
>gi|110277122|gb|DQ667172|vgrG3|:24615-26663
ATGGCAGACAGCACAGGATTACAATTTACCGTCAAGGTGGGGGCCCTGCCCGAGAGCACCTTCGTGGTGG
CCGAGTTTGCGCTTGATGAAGGGCTGAACCGGCCGTTCAACCTGCGCTTGGAGCTGGCAAGCCGCCAGCC
CGACATCGACTTTGGCGCCGTGCTGGACCAGCCGTGCGAGCTGTTGGTTTGGTACAACGGCGAGCTGCAG
CGCCGGGTCTGCGGGGTGGTGAGCGACATGGCGCAGGGTGACAGCGGCTTTCGCCGCACCCGCTATCAGC
TGCTGGTGCTGCCGGCGCTGTGGCGTCTGTCACTTCGCCAAAACTCCCGCATCTTTCAGGCGCAAAAGCC
CGATGAAATCCTCAGCATCCTGTTGCAAGAGCACGGCATCACCGACTATGCGTTTGCGCTGAAAAACGAG
CACGCCAAGCGGGAATATTGCGTCCAGTACCGGGAAACAGACCTCGACTTCGTGAACCGGCTCGCCGCCG
AAGAGGGGATGTTCTACTTCCACGAGTTTGAAGCGGGCAAGCACCGCATCGTCTTTGCCGACGACGCGGC
GGCATTGACTCAAGGCCCCGAGCTCTTCTTCAACCTCGGCAACCGTTCCCTCGAGCAAGGCCCCTATGTG
CGCCAGTTCCACTACCGGGAGGCGGTGCGCCCCTCGGATGTGGAGCTCAAGGACTACAGCTTCAAGACCC
CGGCCTATGGCCTCTCCCACAAAAAGCAGGGCGCTGATCTCGACCATCAACGGGACACCTACCAGCACTT
CGATTTCCCAGGCCGCTACAAACAGGGTGGCAGCGGCAAGGCCTTTGCCCAGCACAGGCTCGATGCGCTG
CGCAACGACGCGGTAGCGGGCAGTGGCAAGTCCAACTGCGCGGCCTTGCAGCCGGGGCAGACCTTCTCAC
TAACCGAACACCCGAACGGCGGCCTCAATACCGACTGGCAAGTCGTACGCATCCAGCACACCGGCTTGCA
GCCTCAGGCGCTGGAAGAGGAGGGTGGCAGCGGCCCCACCGTCTACCACAACGAATTTGGGGTAGTAAAA
GCGAGCAGCACCTGGCGGGCACGCATCGGCAGCCCGGAGGCCCTCCACAAGCCCATGGTGGATGGCCCGC
AAATCGCCATGGTGGTGGGTCCCGAAGGGGAGGAGATTTACTGCGACGAGCACGGCCGGGTGAAGCTGCA
GTTCCCGTGGGACAGATATGGTAGCTCCAATGACCAGAGCTCCTGCTGGGTGCGAGTCTCCCAGGGCTGG
GCCGGTGGTCAGTATGGCATGATGGCCATCCCGCGCATCGGCCACGAGGTTATCGTGAGTTTCCTGGAAG
GGGACCCGGACCAGCCCATCGTGACCGGTCGCACCTATCACGCCACCAACCGGCCGCCGTATGAGTTACC
GGCCAACAAGGCCCGTACCGTGCTGCGCACCGAAACCCACCAGGGCGAGGGTTTCAACGAGCTGCGCTTT
GAAGACCAGGCGGGGCAGGAAGAGATTTATATCCACGGTCAGAAAGATCTGAACGTACTCATCGAGAACA
ATGCGGTCTGGCACATCAAACACGATGAGCATCGGGACATCGACAACGAGCGGGTGACCCGCATCAAGGC
CAACGACCATCTGACGGTGGAGGGTGAGAAGCGCGACCAGATAAAAGCCGACTACTCGCTGACGGTGGAT
GCCAGCCTGCACCAGAAGTTGGGACAGTCCCTGCTGGTGGAAGCCGGACAGGAAGTGCATATCAAGGTGG
GCGACAAGCTGGTGCTGGAGGCTGGTTCTGAAATAACCCTCAAGGGAGGCGGCAGCTTTGTGAAAGTGGA
CCCGAGCGGCATCAAGCTGATGGGCCCAGCCATCAAGCTCAATGCCGGCGGCAGCGCAGGTTCTGGTTCT
GGCTGGGGTGGCAAGGCTCCCGTTGTGCCCAAGGGGGTAGAAGTGGTCAAGGCTCCCGAACTGGTCGAGC
TGGTCAAGGCCATCCCCACCGAGAAGGCGATGGAGGCGTTGCTCAAGGAGCAAGGGCCTGCGCAGACCTT
TTTCGTGCCATCCCGCTAG