SecReT6
Protein ID: 110640432
SecReT6 ID141
T6SS typei1
Gene symbol-
Locus tagECP_0224
StrainEscherichia coli 536
Repliconchromosome [GenBank: NC_008253] [Browse all T6SS(s) in this replicon]
Location [Strand]242751..243251 [-]
Producthypothetical protein
NoteTssD
UniProt IDQ0TLC0
KEGG IDecp:ECP_0224
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.10E-31, Aligned region: 13..150
Protein Sequence: 166 a.a.     [Download]
>gi|110640432|ref|YP_668160.1| hypothetical protein ECP_0224 [Escherichia coli 536]
MRLRRITMANPVYLTLNGELQGLISSGCSSMPSIGNKAQIAHQDQIMVTSLSHGLSRAQNVNHQELTITK
PVDKSSPLLGKAISENECLTCDFVFYRTNRFGINEPYYKLKLANARLSNIGLTIPHTINDSPGQAEESVS
FTYESINWEHSVAGTSAYSLWSERIF
 
Nucleotide Sequence: 501 bp     [Download]
>gi|110640213|ref|NC_008253.1|:c243251-242751 Escherichia coli 536, complete genome
TTGAGATTAAGGAGAATAACAATGGCAAATCCCGTCTATCTGACACTGAACGGAGAACTTCAGGGGCTGA
TTTCATCCGGATGCTCGTCAATGCCGTCCATCGGTAACAAAGCCCAGATTGCACATCAGGATCAGATCAT
GGTGACGTCACTGTCCCATGGTCTGAGCCGTGCGCAGAATGTCAACCATCAGGAGTTGACCATCACGAAA
CCGGTGGACAAATCCTCCCCTCTGCTGGGCAAGGCCATTTCAGAGAATGAATGTCTGACCTGTGATTTTG
TATTCTACCGCACCAACCGCTTTGGAATTAATGAACCGTACTACAAGCTGAAACTGGCTAACGCCCGGCT
CTCAAACATCGGCCTTACCATTCCCCATACCATTAACGACAGTCCTGGGCAGGCGGAAGAGTCTGTGTCA
TTTACCTATGAGAGCATCAATTGGGAGCACAGCGTCGCCGGAACCAGTGCATACAGCCTTTGGAGTGAAC
GGATTTTCTAA

Protein ID: 110640447
SecReT6 ID141
T6SS typei1
Gene symbol-
Locus tagECP_0239
StrainEscherichia coli 536
Repliconchromosome [GenBank: NC_008253] [Browse all T6SS(s) in this replicon]
Location [Strand]263065..263583 [+]
Producthemolysin co-regulated protein
NoteTssD
UniProt IDQ0TLA5
KEGG IDecp:ECP_0239
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.30E-36, Aligned region: 6..155
DCAF15_WD40 [PF14939], Evalue: 0.0034, Aligned region: 93..137
Protein Sequence: 172 a.a.     [Download]
>gi|110640447|ref|YP_668175.1| hemolysin co-regulated protein [Escherichia coli 536]
MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVTVPTDPQSGQPSGQRAHKPFIF
TVALNKAVPLLYNALASGEMLPKVELHWWRTSVEGKQEHYFTTRLTDATIVDMNLHMPHCQDPAQREFTQ
LLAVSLAYRKVEWEHIKSGTSGADDWRAPLEA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|110640213|ref|NC_008253.1|:263065-263583 Escherichia coli 536, complete genome
ATGCCAACCCCATGTTACATTTCAATTACAGGTCAGACCCAGGGGAACATCACTGCCGGTGCTTTCACCG
CAGATTCTGTCGGCAATATCTACGTGCAGGGACACGAAGATGAAATGCTGGTGCAGGAGTTTCTGCATAA
CGTTACTGTTCCAACCGATCCGCAGTCTGGTCAGCCTTCCGGGCAGCGTGCTCACAAACCGTTCATTTTC
ACCGTGGCGCTGAACAAAGCCGTTCCGCTGCTGTACAACGCGCTGGCCTCCGGTGAAATGCTGCCGAAAG
TGGAGCTGCACTGGTGGCGTACCTCTGTTGAAGGCAAGCAGGAGCACTACTTCACCACACGTCTTACTGA
CGCGACGATTGTGGACATGAACCTGCATATGCCGCACTGCCAGGACCCTGCACAGCGTGAGTTTACGCAA
TTGCTCGCAGTATCACTGGCCTACCGTAAGGTTGAGTGGGAGCACATCAAATCCGGTACTTCTGGTGCCG
ATGACTGGCGTGCACCGCTGGAAGCATAA