SecReT6
Protein ID: 110640433
SecReT6 ID141
T6SS typei1
Gene symbol-
Locus tagECP_0225
StrainEscherichia coli 536
Repliconchromosome [GenBank: NC_008253] [Browse all T6SS(s) in this replicon]
Location [Strand]243248..244606 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ0TLB9
KEGG IDecp:ECP_0225
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.30E-45, Aligned region: 91..156
DUF3702 [PF12486], Evalue: 2.30E-45, Aligned region: 258..271
DUF3702 [PF12486], Evalue: 2.30E-45, Aligned region: 288..434
ImpA-rel_N [PF06812], Evalue: 1.30E-20, Aligned region: 41..101
ImpA-rel_N [PF06812], Evalue: 1.30E-20, Aligned region: 254..261
Protein Sequence: 452 a.a.     [Download]
>gi|110640433|ref|YP_668161.1| hypothetical protein ECP_0225 [Escherichia coli 536]
MSNNALTQTIVTGSDPRALPEFSAIREEINKANHPSQPELNWKLVESLALSIFKANGVDLHTATYYTLAR
TRNQGLAGFCEGAELLAAMIIHEWDKFWPQSGPARTEMLDWFNTRTGNILRQQVSFSENDLSLLYRTERA
LQLICDKLQQVELKRQPRVENLLYFVQNTRKRFEPQPRNRTDTAAQTMVRTLVYAPEGTASATAETMPPL
PDLPEMRVGVRGVADNADKAKQGDTVKGFVAGAACTAVIASALWWWQAYPMQQQLTQVRDTTQGAATVWL
ASPVLKEYEQYLQQLLNAPPLQPLETGMQMMRTADTLWPESLQQQEASRMWSNTLRNRAQASPQMKGWQQ
ARQNLRDFADLMMKKETEKQGFTLSYIKTVTWQAERLLNQETPLEYLLTQYQETRTQKQDTQALEKEINE
RLDGLLSRWLLLKNTGQDMATDNRTEPVHPTH
 
Nucleotide Sequence: 1359 bp     [Download]
>gi|110640213|ref|NC_008253.1|:c244606-243248 Escherichia coli 536, complete genome
ATGAGCAATAACGCACTGACACAAACTATCGTTACCGGCAGCGATCCGCGCGCCCTGCCGGAGTTCAGCG
CCATCCGCGAAGAAATTAACAAAGCTAACCACCCGTCACAGCCGGAGCTGAACTGGAAACTGGTGGAATC
GCTGGCGCTGTCGATTTTTAAGGCCAACGGGGTGGATTTGCATACCGCCACCTACTATACGCTGGCACGT
ACACGTAATCAGGGACTGGCAGGGTTCTGTGAAGGCGCGGAACTGCTGGCTGCGATGATCATCCACGAAT
GGGATAAATTCTGGCCGCAGAGTGGCCCGGCGCGGACTGAGATGCTGGACTGGTTCAACACCCGCACCGG
GAATATCCTGCGCCAGCAGGTTTCCTTTTCCGAAAATGATCTTTCGTTGCTCTACCGCACGGAACGGGCT
TTGCAGCTTATCTGCGACAAACTCCAGCAAGTGGAACTGAAGCGCCAGCCGCGCGTGGAAAATCTGCTTT
ATTTTGTGCAGAACACACGCAAGCGGTTTGAGCCGCAGCCCAGAAACCGTACTGATACGGCGGCACAGAC
CATGGTCAGAACGCTGGTCTATGCGCCTGAAGGCACGGCTTCCGCCACAGCGGAAACCATGCCCCCCCTA
CCCGACCTGCCGGAAATGCGGGTGGGGGTGCGCGGTGTGGCAGATAACGCCGACAAAGCAAAACAGGGCG
ACACGGTAAAAGGTTTTGTTGCCGGTGCCGCCTGTACTGCCGTTATCGCATCTGCACTCTGGTGGTGGCA
GGCGTATCCGATGCAGCAGCAGCTTACACAGGTCAGGGATACCACACAGGGAGCCGCCACCGTCTGGTTG
GCCTCCCCGGTACTGAAAGAATATGAACAGTACCTGCAACAGCTTCTGAATGCCCCGCCACTACAGCCGC
TGGAAACCGGAATGCAGATGATGCGCACCGCAGACACCCTCTGGCCGGAAAGCCTGCAACAGCAGGAAGC
CAGCAGGATGTGGAGCAACACGCTGAGAAACCGGGCGCAAGCCAGTCCGCAGATGAAGGGCTGGCAACAA
GCGCGGCAGAATTTGCGGGATTTTGCAGATTTGATGATGAAGAAGGAGACGGAGAAACAAGGTTTCACCC
TATCGTATATCAAAACGGTGACCTGGCAGGCCGAACGGTTACTGAATCAAGAAACACCACTGGAGTACCT
GCTGACGCAGTACCAGGAGACCCGTACACAGAAGCAGGACACACAGGCGTTGGAAAAAGAGATCAACGAA
CGGCTGGACGGGCTGTTAAGCCGCTGGCTGCTGCTGAAAAATACCGGACAGGATATGGCAACGGATAACA
GAACCGAACCTGTCCATCCAACTCATTGA

Protein ID: 110640435
SecReT6 ID141
T6SS typei1
Gene symbol-
Locus tagECP_0227
StrainEscherichia coli 536
Repliconchromosome [GenBank: NC_008253] [Browse all T6SS(s) in this replicon]
Location [Strand]248164..249672 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ0TLB7
KEGG IDecp:ECP_0227
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 6.20E-07, Aligned region: 76..133
Protein Sequence: 502 a.a.     [Download]
>gi|110640435|ref|YP_668163.1| hypothetical protein ECP_0227 [Escherichia coli 536]
MTGWHGLLRRYATPATGRENKNMAMDLRNPDVWLAHLLENLPEDKLSAALDDGNADWEFVDSEIVKLGSL
AHSQLDIPELQRRGLMLLASETKDFRLLAHLLRTLQHAGDILLASRMLAQYTEHYWTCAAPQNMAHKKRF
AAQVIKRFESAVQDFAGNAATIQRDALLGELAKLAQCWQAHNASELAKATDDLFSLFQRAFRDVAPEMTS
SARSAAIAPQATTGYVPDMSPHTVAAQPPVAATPIPQVTVESHDDKAWRDTLLKVAAILCERQPESPQGY
RLRRHALWQTITSTPQAESDGRTPLAAFPVDMMDDYLARLNNADMALWQQVEKSLLLAPYWLDGHYLSAQ
TALRLGYKQVADAIRDEVTDFLARLPALINLLFNDRTPFVSEQTKQWLASSGSVNQTVPVVQTDEELQAA
KACFDEYGLEAALRYLENLPEGDPRHQFHRQFFGAQLLEEAGMVQLAQQQYRMLFRTGLHMMLSEWEPSL
LKALEQKLTAEQ
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|110640213|ref|NC_008253.1|:c249672-248164 Escherichia coli 536, complete genome
TTGACGGGCTGGCACGGGTTATTGCGCCGCTACGCGACGCCTGCCACTGGGCGGGAGAATAAGAATATGG
CAATGGACTTACGTAATCCCGATGTATGGCTTGCACACCTGCTGGAAAACCTGCCAGAAGATAAGCTGTC
CGCCGCGCTTGATGATGGCAATGCAGACTGGGAGTTTGTCGACAGCGAAATCGTCAAGCTCGGTTCACTG
GCGCACAGCCAGCTTGATATCCCGGAACTTCAGCGCCGGGGCCTGATGCTTCTGGCCTCAGAAACCAAAG
ATTTTCGCCTGCTGGCCCACTTGCTGCGTACCCTGCAACATGCCGGTGATATTCTGCTGGCCTCCAGGAT
GCTGGCACAATATACAGAGCACTACTGGACATGCGCCGCACCGCAGAACATGGCCCACAAAAAACGCTTT
GCCGCCCAGGTGATAAAACGCTTTGAGTCTGCCGTTCAGGACTTTGCCGGGAATGCTGCGACAATACAGC
GCGATGCTTTGCTGGGAGAGCTGGCAAAACTGGCACAGTGCTGGCAGGCGCACAACGCGTCTGAGCTGGC
AAAGGCGACAGACGATTTATTTTCCCTGTTTCAGCGCGCGTTTCGTGATGTAGCGCCTGAAATGACATCA
TCTGCACGAAGCGCCGCCATTGCGCCGCAGGCCACGACCGGATATGTACCGGATATGTCACCGCACACGG
TTGCCGCTCAGCCTCCTGTTGCAGCCACTCCAATCCCGCAGGTCACCGTTGAAAGCCACGACGATAAAGC
ATGGCGCGACACCCTGCTAAAGGTGGCCGCCATTCTCTGTGAGCGCCAGCCGGAGTCACCGCAGGGTTAC
CGACTGCGCCGCCATGCGCTGTGGCAAACCATCACCAGTACCCCGCAGGCAGAAAGCGATGGCCGGACCC
CACTGGCAGCCTTCCCTGTCGATATGATGGATGATTACCTGGCGCGGCTGAACAATGCCGACATGGCGCT
GTGGCAGCAGGTGGAAAAAAGCCTGCTGCTGGCCCCGTACTGGCTGGACGGTCATTACCTCTCAGCACAG
ACCGCGCTGCGCCTCGGTTATAAACAGGTGGCGGATGCTATCCGTGATGAAGTTACCGATTTTCTGGCCC
GCCTGCCCGCACTGATCAACCTGTTGTTTAACGACCGCACTCCGTTTGTGTCCGAACAGACGAAACAGTG
GCTGGCATCATCCGGCTCAGTCAACCAGACCGTCCCGGTTGTACAGACCGATGAAGAATTACAGGCGGCC
AAGGCGTGCTTCGATGAATACGGGCTGGAAGCCGCGCTGCGGTACCTGGAAAACCTGCCCGAAGGTGATC
CCCGCCACCAGTTTCACCGCCAGTTTTTCGGCGCGCAGTTACTGGAAGAGGCCGGTATGGTTCAGCTTGC
ACAACAGCAGTACCGGATGCTCTTCAGAACAGGATTACACATGATGCTATCCGAATGGGAGCCTTCCCTG
CTGAAAGCACTGGAACAAAAACTCACGGCAGAACAGTAA