SecReT6
Protein ID: 110640440
SecReT6 ID141
T6SS typei1
Gene symbol-
Locus tagECP_0232
StrainEscherichia coli 536
Repliconchromosome [GenBank: NC_008253] [Browse all T6SS(s) in this replicon]
Location [Strand]255241..255765 [-]
Productlipoprotein
NoteTssJ
UniProt IDQ0TLB2
KEGG IDecp:ECP_0232
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.10E-32, Aligned region: 14..167
Protein Sequence: 174 a.a.     [Download]
>gi|110640440|ref|YP_668168.1| lipoprotein [Escherichia coli 536]
MNGKAFLACVLMSVVLTGCETAKKISQVIRNPDIQVGKLMEQSTELTVTLLTEPDSNLTADGEAAPVDVQ
LVYLSDDSKFQAADYDQIATTALPDVLGKNYIDHQDFNLLPDTVKTLPPIKLDEKTGYIGVIAYFSDDQA
TEWKQIEPVESIGHHYRLLVHIRASAIEMKKEEN
 
Nucleotide Sequence: 525 bp     [Download]
>gi|110640213|ref|NC_008253.1|:c255765-255241 Escherichia coli 536, complete genome
ATGAACGGCAAAGCGTTTCTGGCCTGCGTTCTGATGAGCGTTGTGTTAACTGGCTGTGAAACAGCGAAAA
AAATCAGCCAGGTGATCCGCAATCCGGATATTCAGGTCGGAAAGCTGATGGAGCAGTCAACCGAACTGAC
CGTCACGCTGCTGACCGAGCCGGACAGCAACCTGACGGCGGACGGCGAAGCCGCGCCGGTGGATGTCCAG
TTGGTGTATCTGAGCGACGACTCCAAATTCCAGGCCGCCGATTACGATCAGATTGCCACCACCGCGCTGC
CCGACGTGCTGGGGAAGAACTATATCGATCACCAGGACTTCAACCTGTTGCCGGACACCGTAAAAACACT
GCCGCCGATCAAGCTGGATGAGAAAACCGGTTATATCGGTGTCATTGCCTATTTTTCAGACGACCAGGCC
ACAGAATGGAAACAAATTGAGCCGGTAGAAAGTATCGGCCACCACTATCGCCTGCTGGTGCATATCCGCG
CCAGTGCGATTGAGATGAAAAAAGAGGAAAACTGA