SecReT6
Protein ID: 110640441
SecReT6 ID141
T6SS typei1
Gene symbol-
Locus tagECP_0233
StrainEscherichia coli 536
Repliconchromosome [GenBank: NC_008253] [Browse all T6SS(s) in this replicon]
Location [Strand]255762..257150 [-]
Producthypothetical protein
NoteFha
UniProt IDQ0TLB1
KEGG IDecp:ECP_0233
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 0.0011, Aligned region: 76..140
Protein Sequence: 462 a.a.     [Download]
>gi|110640441|ref|YP_668169.1| hypothetical protein ECP_0233 [Escherichia coli 536]
MAIRPAPASAEPALLVSRKYRPPSQSESGNNSMEPLMAEEKQQSRQASLTLQVMNGNELESGRAAKCLFS
ENGGDIGHTPECHWQVQDRAGSIAARACTVIRHDGAYCLRCLTPGLMINLAPASSDALIRLRQGDEIQLG
ALALKVFLHDGAAVTYDERMATPETIVMNRDSLADTLLTTEGQPAYPGMPFQHQLAPTVAHGFSSDPLQA
LQTESLMVADDPIAPRVSRPVAPASDLTGANGINTPFMDLPPGNARHEDGDEFSAMAQYHLAVTPLLRGM
ECPLTLHNSQDADEFLEEAGRALQAAIKGLLSLQQQQNSLSDKHLRPLEDNPLRLDMDYATALNVMFAEG
KSPVHLAAPAAIAESLRNIRHHEEANRAAIVEALRVMLDAFSPGNLMRRFAQYRRSHELRQKMDNAWAWQ
MYSNYYDELASSRQQGFEMLFNEVYAQVYDRVLREKQREPEA
 
Nucleotide Sequence: 1389 bp     [Download]
>gi|110640213|ref|NC_008253.1|:c257150-255762 Escherichia coli 536, complete genome
TTGGCGATCCGGCCAGCTCCCGCCTCGGCAGAACCAGCTTTATTGGTCAGCCGAAAGTACCGCCCGCCAT
CACAATCCGAATCAGGGAATAATTCTATGGAACCACTTATGGCTGAGGAAAAACAGCAATCCCGCCAGGC
CTCACTGACTTTACAGGTGATGAATGGCAACGAACTGGAAAGCGGACGCGCCGCAAAATGCCTGTTCAGC
GAAAACGGCGGTGATATTGGCCATACGCCGGAATGTCACTGGCAGGTACAGGACCGGGCGGGAAGCATTG
CTGCGCGTGCCTGTACCGTTATCCGGCACGACGGAGCCTATTGCCTGCGGTGCCTGACGCCGGGACTGAT
GATTAATCTGGCCCCGGCCTCTTCCGATGCGCTCATCCGCCTGCGCCAGGGGGATGAGATCCAGCTCGGC
GCACTGGCGCTGAAAGTGTTTCTGCATGACGGTGCAGCTGTTACCTATGACGAGCGGATGGCGACCCCGG
AAACGATTGTAATGAACCGCGACAGTCTGGCGGACACCCTGCTGACCACCGAGGGACAACCGGCGTATCC
GGGAATGCCGTTCCAGCATCAGCTTGCCCCCACGGTGGCGCACGGTTTTTCCAGCGATCCGCTCCAGGCA
CTCCAGACGGAAAGCCTGATGGTGGCAGATGATCCGATCGCCCCACGCGTTTCCCGGCCCGTAGCCCCCG
CATCCGATCTGACAGGTGCAAACGGGATCAACACGCCGTTTATGGATCTACCGCCCGGCAATGCCCGTCA
TGAGGACGGCGATGAATTTTCTGCCATGGCGCAGTACCACCTGGCCGTAACCCCGCTGCTGCGCGGTATG
GAGTGTCCGCTGACGCTGCACAATTCTCAGGATGCGGATGAGTTTCTCGAAGAGGCCGGACGGGCGTTGC
AGGCCGCCATTAAGGGATTGCTGAGTCTGCAACAACAACAGAATAGCCTGTCGGATAAACACCTGCGTCC
ACTGGAAGACAACCCGTTGCGCCTTGATATGGACTATGCCACCGCGCTGAACGTCATGTTCGCCGAGGGT
AAAAGCCCGGTACATCTCGCAGCACCTGCGGCCATCGCCGAAAGCCTGCGCAACATCCGGCATCATGAAG
AGGCCAACCGGGCGGCGATTGTGGAAGCGTTGCGTGTCATGCTGGACGCCTTCTCGCCGGGCAACCTGAT
GCGCCGCTTTGCGCAATACCGCCGCAGCCATGAGCTGCGCCAGAAAATGGACAACGCCTGGGCATGGCAG
ATGTACAGCAACTATTACGATGAACTGGCCTCCAGCCGACAGCAGGGATTTGAAATGCTGTTCAATGAAG
TTTATGCCCAGGTCTATGACCGGGTGCTGCGCGAAAAACAGCGGGAGCCGGAAGCATGA