SecReT6
Protein ID: 110640443
SecReT6 ID141
T6SS typei1
Gene symbol-
Locus tagECP_0235
StrainEscherichia coli 536
Repliconchromosome [GenBank: NC_008253] [Browse all T6SS(s) in this replicon]
Location [Strand]258072..259922 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ0TLA9
KEGG IDecp:ECP_0235
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.10E-190, Aligned region: 8..616
Protein Sequence: 616 a.a.     [Download]
>gi|110640443|ref|YP_668171.1| hypothetical protein ECP_0235 [Escherichia coli 536]
MISVAFEERYYREELDYLRQLGKLLAQEKPHLAHFLAEKEGDPDVERLMEAFAFMSGSLRQKLEDEFPEF
THGLIRMLWANYLRPVPAMTVIAYEPKTDQLKVPVQVCRNELIRSRSEKSSLTAQKVLPDNHDKIVSSVA
CHFTLARDIWLQPLRILDTRNASSLKEGIIDISFTADNNVSPAMLDLNKITFWLGNEDDYTRHQLYLWFC
ECLMDAELIAGEHSLPLPDLWLDAAGFDNQDALLPWPKNVHSGYRVLQEYFCYPEAFFFFHLRDVAPLPD
DFPVSAFTLRLHFNRPLPADIKLRQDSLRLHCTPAINLFTHYAEPVRPDGRMAEYPLRASHKHPDAYDIF
QVSTVTSKIKVSGTDSSPGSQVRVWPEFESFQHQMEYSRQREVVYWHHRTKTSLFHYGLEHSIAFVHADG
SIPGSSRFNDDVITTSLICTNRMIPARLHTGDICVAVNKNPAVASFRNVTRPTQPLWPVTDGDMHWSLIS
AMNLNYLSLLDRETLIQILRTFDLPGAHHPQRARLSRQKLDAIEKLETKPVDRLFKGVPVRGLATTLWIR
PDPFICEGEIYLLGTVLSHFFALYASINSYHCLKIINTESQEAWEWQEKMGQHALI
 
Nucleotide Sequence: 1851 bp     [Download]
>gi|110640213|ref|NC_008253.1|:c259922-258072 Escherichia coli 536, complete genome
GTGATCTCTGTGGCTTTTGAAGAACGTTACTACCGCGAAGAACTGGATTATCTGCGCCAGCTTGGCAAAC
TGTTGGCGCAGGAAAAACCGCATCTGGCCCATTTTCTGGCCGAGAAAGAGGGTGATCCGGACGTGGAGCG
TCTGATGGAAGCCTTTGCCTTTATGTCCGGTAGCCTGCGCCAGAAACTTGAGGACGAATTCCCCGAATTC
ACCCATGGGCTAATCCGTATGCTGTGGGCAAACTATTTACGCCCGGTTCCGGCCATGACGGTTATTGCCT
ATGAACCCAAAACCGATCAGTTAAAAGTCCCTGTTCAGGTCTGTCGTAATGAACTGATCAGAAGCCGCTC
AGAAAAGTCCTCCCTGACTGCTCAGAAGGTGCTGCCTGACAATCATGATAAAATCGTTTCTTCCGTAGCC
TGCCATTTCACGCTGGCGCGCGATATCTGGCTGCAACCACTGCGCATTCTCGATACCCGCAACGCCAGCA
GTCTGAAAGAAGGCATCATAGATATCAGTTTTACCGCAGATAACAATGTCTCCCCCGCCATGCTTGACCT
GAACAAAATCACGTTCTGGCTGGGTAATGAAGACGATTATACCCGACACCAGCTTTATCTGTGGTTTTGC
GAATGCCTGATGGATGCGGAACTGATTGCCGGAGAGCACAGCCTGCCGCTGCCGGATCTGTGGCTGGATG
CTGCGGGTTTTGACAACCAGGATGCCCTGCTGCCGTGGCCGAAAAATGTCCACAGCGGCTACCGCGTGCT
TCAGGAGTATTTCTGCTATCCCGAAGCCTTCTTCTTTTTCCATCTGCGCGATGTTGCGCCGCTACCAGAC
GATTTCCCGGTGAGTGCGTTTACGCTGCGCCTGCACTTTAACCGCCCGTTACCTGCCGACATCAAGCTGC
GCCAGGATTCGCTGCGTCTGCACTGTACGCCAGCCATTAACCTGTTTACGCATTATGCGGAACCCGTCAG
GCCGGATGGGCGGATGGCGGAATACCCGCTGCGCGCCAGCCATAAGCATCCGGACGCCTATGACATTTTT
CAGGTCAGTACAGTCACCAGTAAAATCAAAGTGTCAGGGACTGATTCCAGCCCCGGCAGCCAGGTGCGTG
TCTGGCCCGAATTTGAAAGTTTCCAGCACCAGATGGAGTACAGCCGCCAGCGGGAAGTCGTCTACTGGCA
TCACCGGACTAAAACGTCCCTGTTTCACTACGGGCTTGAACATAGTATCGCCTTTGTCCATGCAGACGGT
AGCATTCCGGGCAGCTCACGGTTTAACGATGACGTGATCACCACGTCATTAATCTGTACCAACCGTATGA
TCCCTGCCCGGCTGCATACCGGTGATATCTGCGTGGCCGTCAACAAAAATCCGGCAGTGGCCTCATTTCG
TAATGTCACGCGCCCGACACAGCCGCTCTGGCCAGTCACGGACGGCGACATGCACTGGTCGCTGATTTCC
GCGATGAACCTGAACTACCTCTCCCTGCTGGACAGGGAGACACTGATCCAGATCCTGCGGACCTTCGACC
TGCCAGGCGCTCACCATCCGCAGCGGGCCAGACTGTCACGCCAGAAACTGGATGCCATAGAAAAACTCGA
AACCAAACCTGTTGACAGGTTGTTTAAAGGCGTACCGGTTCGCGGGCTGGCGACCACGCTGTGGATACGT
CCCGATCCGTTTATCTGCGAAGGTGAAATTTATCTTCTGGGTACCGTGCTCTCGCACTTCTTTGCCCTCT
ACGCCAGCATCAATTCGTACCACTGTCTGAAAATCATTAACACGGAAAGTCAGGAGGCTTGGGAATGGCA
GGAGAAAATGGGCCAGCACGCCCTGATATAG