SecReT6
Protein ID: 110640444
SecReT6 ID141
T6SS typei1
Gene symbol-
Locus tagECP_0236
StrainEscherichia coli 536
Repliconchromosome [GenBank: NC_008253] [Browse all T6SS(s) in this replicon]
Location [Strand]259919..260344 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ0TLA8
KEGG IDecp:ECP_0236
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.90E-21, Aligned region: 30..123
Protein Sequence: 141 a.a.     [Download]
>gi|110640444|ref|YP_668172.1| hypothetical protein ECP_0236 [Escherichia coli 536]
MQRRDSGPTGSLFERIREAANPPSYQNPKEALIRSIRRNLRQVLNTRSGSCYGSPELGITDLNDESLASS
DFRREIRKSISQCILHYEPRITDVVVTAAAPDEYAPVELRFHIVATIDVSKTKGVFEFDILLDNHQRYCV
E
 
Nucleotide Sequence: 426 bp     [Download]
>gi|110640213|ref|NC_008253.1|:c260344-259919 Escherichia coli 536, complete genome
ATGCAAAGACGGGATTCAGGACCAACCGGCAGTCTTTTTGAACGTATCCGTGAGGCGGCAAATCCGCCTT
CATATCAGAATCCAAAAGAAGCACTGATACGTTCCATCAGACGTAACCTGCGACAGGTCCTGAATACCCG
CTCCGGCAGTTGTTATGGCTCACCGGAGCTGGGGATTACTGATTTAAATGATGAATCGCTGGCCTCCAGC
GATTTCAGACGAGAAATCCGTAAGTCCATTAGCCAGTGCATTTTACATTACGAACCTCGTATTACCGATG
TTGTTGTTACGGCTGCGGCACCGGATGAATACGCCCCTGTGGAACTGCGTTTTCATATTGTGGCTACGAT
CGATGTCAGCAAGACCAAGGGAGTGTTTGAATTTGACATTTTGCTGGACAACCATCAACGCTATTGTGTG
GAGTGA