SecReT6
Protein ID: 110640446
SecReT6 ID141
T6SS typei1
Gene symbol-
Locus tagECP_0238
StrainEscherichia coli 536
Repliconchromosome [GenBank: NC_008253] [Browse all T6SS(s) in this replicon]
Location [Strand]261856..262359 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ0TLA6
KEGG IDecp:ECP_0238
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.40E-48, Aligned region: 10..162
Protein Sequence: 167 a.a.     [Download]
>gi|110640446|ref|YP_668174.1| hypothetical protein ECP_0238 [Escherichia coli 536]
MSKMNNNGGSVAPKERISVRYTPKVDGVAADIELPLNLLITGNLKGKPDNTPLDERTAIAINRYNLNAVI
SEADIEREFVVPAELSDAPNEQMYVNLKVKSMDDLSPDHIASQVPEIKRLLELREALVALKSPLGNIPAF
RAQLQALLENEDTREQLIQELGIAVQK
 
Nucleotide Sequence: 504 bp     [Download]
>gi|110640213|ref|NC_008253.1|:c262359-261856 Escherichia coli 536, complete genome
ATGAGCAAAATGAACAACAATGGCGGCAGTGTCGCGCCGAAAGAAAGAATCAGCGTTCGGTATACACCAA
AAGTTGATGGGGTGGCTGCTGATATCGAATTGCCGCTGAATTTATTGATCACCGGCAATCTGAAAGGGAA
ACCAGATAACACGCCGTTGGATGAGCGAACTGCCATTGCTATCAACCGCTATAACCTCAACGCAGTCATT
TCAGAAGCTGACATTGAACGGGAGTTTGTTGTTCCGGCTGAACTCAGTGACGCTCCCAATGAGCAAATGT
ACGTCAACCTGAAAGTCAAATCTATGGATGACCTTTCTCCTGACCATATTGCCAGCCAGGTACCAGAAAT
AAAACGTCTGCTCGAATTGCGTGAAGCCCTGGTCGCACTTAAGTCTCCACTAGGCAATATTCCGGCCTTC
CGCGCACAACTTCAGGCGCTACTGGAAAACGAAGACACCCGCGAGCAGCTGATCCAGGAACTGGGTATCG
CCGTTCAGAAATAA