SecReT6
Protein ID: 110640448
SecReT6 ID141
T6SS typei1
Gene symbol-
Locus tagECP_0240
StrainEscherichia coli 536
Repliconchromosome [GenBank: NC_008253] [Browse all T6SS(s) in this replicon]
Location [Strand]263804..265786 [+]
ProductVgr-like protein
NoteTssI
UniProt IDQ0TLA4
KEGG IDecp:ECP_0240
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.80E-62, Aligned region: 34..328
Phage_base_V [PF04717], Evalue: 1.30E-26, Aligned region: 367..459
Gp5_C [PF06715], Evalue: 6.20E-05, Aligned region: 501..523
Gp5_C [PF06715], Evalue: 6.20E-05, Aligned region: 516..539
Gp5_C [PF06715], Evalue: 6.20E-05, Aligned region: 546..563
Gp5_C [PF06715], Evalue: 6.20E-05, Aligned region: 567..584
Protein Sequence: 660 a.a.     [Download]
>gi|110640448|ref|YP_668176.1| Vgr-like protein [Escherichia coli 536]
MSLKGLRFTLEVDGQEPDTFAVVNFRLIQNQSYPFVMSVDVASDSFMQTAEMLLEKKATLTIWQGVIPQR
YVTGVVAGFGMQENNGWQMRYHLRIEPPLWRCGLRQNFRIFQQQDIRTISATLLNENGVTEWTPLFYEDH
PAREFCVQYGESDLAFLARLWAEEGIFFFERFAADSPEQKLTLCDDVAGLSQAGEFPFNPDASTGAETEC
VSMFRYEAHVRPSSVQSQDYTFKVPDWPGMYEQQGESLNGQLEQYEIFDYPGRFKDEQHGKDFTLYQMES
LRSDAEKATGQSNSPKLWPGTRFTLTGHPQKMLNREWQVVQSILSGDQPQALHGSQGRGTTLGNQLEVIP
ADRTWRPRLQSKPKVDGPQSAIVTGPAGEEIFCDEHGRVRVKFHWDRYNPATEASSCWVRVSQAWAGPGF
GNLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHEDNRSPGSLPGTKTQMTIRSKTYKGSGFNELRFEDATG
GEQVYIHAQKNMDTEVLNNRTTDVKADHTETIGNDQKITVGLGQTVNVGSKKEGGHDQKVTVANDQHLTI
KNDRHKVVNNNQTSKVTGTDTEEVVKKQSIKIGDNYELKVEHGTNIISGDSIELICGQGESGTCSIKLEK
TGKIIIRGTEFLFEATGPVDIKGKDIHLNG
 
Nucleotide Sequence: 1983 bp     [Download]
>gi|110640213|ref|NC_008253.1|:263804-265786 Escherichia coli 536, complete genome
ATGTCCTTAAAAGGTCTTCGCTTTACGCTGGAGGTTGACGGCCAGGAGCCGGACACCTTTGCAGTGGTGA
ATTTCAGGTTAATCCAGAACCAGTCTTATCCGTTTGTGATGAGTGTGGATGTCGCCAGCGATTCTTTTAT
GCAGACGGCGGAGATGCTGCTGGAGAAGAAGGCAACGCTGACCATCTGGCAGGGCGTCATCCCGCAGCGT
TATGTCACAGGCGTGGTAGCAGGGTTTGGTATGCAGGAGAATAACGGCTGGCAGATGCGTTATCACCTGC
GTATTGAGCCGCCGTTATGGCGGTGCGGGCTGCGGCAGAACTTCCGCATCTTCCAGCAGCAGGATATCCG
GACGATATCGGCCACGTTACTGAACGAGAACGGCGTCACGGAGTGGACGCCGCTGTTTTATGAGGACCAT
CCGGCGCGGGAGTTCTGTGTCCAGTACGGGGAAAGCGACCTGGCGTTTCTGGCGCGGCTGTGGGCGGAGG
AGGGTATTTTCTTCTTTGAGCGGTTTGCGGCGGACAGTCCGGAGCAGAAGCTGACGCTGTGCGACGATGT
GGCGGGGCTGTCACAGGCGGGAGAGTTTCCGTTTAACCCGGACGCATCGACAGGAGCGGAGACGGAGTGT
GTCAGTATGTTCCGTTATGAGGCGCATGTCCGCCCGTCGTCGGTGCAGAGCCAGGATTACACGTTTAAGG
TGCCGGACTGGCCGGGGATGTATGAGCAGCAGGGTGAGAGCCTGAACGGACAGCTTGAACAGTATGAAAT
ATTTGATTATCCGGGAAGGTTCAAGGATGAGCAGCACGGCAAGGATTTCACGCTGTACCAGATGGAGAGC
CTGCGCAGTGATGCGGAAAAGGCCACAGGGCAGAGTAATTCGCCGAAGCTGTGGCCGGGAACGCGGTTTA
CGCTGACGGGGCATCCGCAGAAGATGCTGAACCGTGAATGGCAGGTGGTACAGAGCATTCTGTCAGGAGA
CCAGCCGCAGGCGCTTCACGGCAGCCAGGGGAGAGGAACCACGCTGGGCAATCAGTTAGAGGTGATACCG
GCAGACCGGACGTGGCGTCCACGGCTGCAAAGCAAACCGAAGGTGGACGGGCCACAGAGCGCCATTGTCA
CCGGTCCTGCGGGAGAGGAAATCTTCTGCGACGAACATGGCCGGGTACGGGTGAAGTTTCACTGGGACAG
GTATAACCCGGCAACGGAGGCGAGTTCGTGCTGGGTTAGGGTATCGCAGGCGTGGGCGGGGCCGGGGTTT
GGTAACCTGGCGATACCGCGCGTGGGCCAGGAGGTGATTGTTGACTTCCTGAACGGGGACCCGGACCAGC
CGATAATCATGGGGCGGACGTACCATGAGGACAACCGTTCGCCGGGGAGCCTGCCGGGGACGAAGACGCA
GATGACGATACGGTCGAAGACCTATAAAGGAAGCGGGTTTAACGAGCTGCGGTTTGAAGACGCCACGGGC
GGTGAACAGGTCTATATCCACGCGCAGAAGAACATGGATACGGAGGTGCTGAATAATCGGACGACGGATG
TGAAGGCTGACCACACGGAGACCATTGGTAACGACCAGAAGATAACGGTGGGGTTGGGCCAGACGGTGAA
TGTGGGGAGCAAAAAGGAAGGTGGTCATGACCAGAAAGTGACGGTAGCGAACGATCAGCATCTCACGATA
AAAAATGACCGGCACAAGGTTGTAAATAACAACCAGACAAGCAAGGTGACGGGAACTGATACCGAAGAAG
TCGTCAAAAAACAGAGTATTAAAATAGGTGATAATTACGAACTGAAAGTTGAGCATGGTACAAATATCAT
ATCTGGGGACAGTATTGAGCTAATTTGTGGGCAGGGAGAGAGCGGGACTTGTTCCATAAAACTGGAGAAA
ACAGGAAAGATAATAATACGGGGGACGGAGTTTCTATTTGAGGCTACCGGTCCTGTAGATATTAAAGGAA
AAGATATTCATCTGAACGGATAG