SecReT6
Protein ID: 110640450
SecReT6 ID141
T6SS typei1
Gene symbol-
Locus tagECP_0242
StrainEscherichia coli 536
Repliconchromosome [GenBank: NC_008253] [Browse all T6SS(s) in this replicon]
Location [Strand]266932..268371 [+]
Producthypothetical protein
NotePAAR
UniProt IDQ0TLA2
KEGG IDecp:ECP_0242
PDB IDNA
Domain hit(s) vs Pfam DUF4150 [PF13665], Evalue: 1.50E-23, Aligned region: 14..116
Peptidase_C39 [PF03412], Evalue: 4.70E-07, Aligned region: 352..474
PAAR_motif [PF05488], Evalue: 6.50E-05, Aligned region: 78..106
Peptidase_C39_2 [PF13529], Evalue: 0.00024, Aligned region: 354..391
Peptidase_C39_2 [PF13529], Evalue: 0.00024, Aligned region: 431..455
Protein Sequence: 479 a.a.     [Download]
>gi|110640450|ref|YP_668178.1| hypothetical protein ECP_0242 [Escherichia coli 536]
MGNYHIGDGECRFRVVCSSPDVCEVGGYKVPFDSYQTLDSERQYSSTVWARGCRALNVGSVIAGTQSNAG
KGVISGTSQGTGDCVILTGSPTVTIEGKPVAYHGSVVGINNHNCLGKLYTKIKSPMISVIDRTFNYERTA
EVIHDLLLLKDLLSVGNIFDGDISPEVKNDLFQIKDPDQSWGEFFSIKNIRESLRNGIEGDKSQIREWFG
ENTLTQMGNGAITTLHGVADLALVTFDALLDTATATVACPIGEDGLCEQANINLNEKEQALFNISNSLIN
GQAWDALKKMIMDTNNGDQIALEHFASFLWGFMIPAKIPEENISGKVFVEPVVLEGGAGGNWTVFDEVLD
SNVIKQLTLTGCGAACGEMLLRDRYIFVTQNVIGTELTSMTSLANKLNKFDVGWEGNAVNESSLYALSNT
GSWGAMMWDSGSKVGHWVLVKGVDDAGNVIIYDPYQGSRYLMTEQEFKEVWNGHSVYKP
 
Nucleotide Sequence: 1440 bp     [Download]
>gi|110640213|ref|NC_008253.1|:266932-268371 Escherichia coli 536, complete genome
ATGGGTAACTATCATATCGGGGATGGTGAATGTAGATTTAGAGTCGTGTGTTCTTCACCAGATGTATGTG
AAGTAGGAGGTTACAAGGTTCCTTTTGACAGTTACCAGACTTTAGATAGTGAAAGACAGTACAGTTCAAC
GGTATGGGCGCGTGGATGCAGAGCTTTAAATGTTGGTTCAGTGATTGCTGGAACTCAAAGTAATGCCGGT
AAAGGTGTCATATCCGGTACATCTCAAGGAACGGGTGACTGTGTTATTTTAACGGGAAGTCCGACTGTAA
CAATAGAAGGGAAACCTGTTGCTTATCATGGTTCAGTTGTTGGGATTAATAACCACAACTGCCTTGGTAA
ATTGTATACCAAAATAAAATCACCAATGATTTCTGTCATTGATAGAACTTTTAATTATGAAAGGACTGCT
GAAGTAATACACGATTTACTGCTTCTGAAGGATCTCCTCTCTGTTGGTAATATTTTTGACGGAGATATTT
CACCTGAGGTTAAAAATGATTTATTTCAAATAAAAGATCCTGACCAATCATGGGGGGAGTTTTTTTCAAT
AAAGAATATCAGAGAATCTCTCAGGAATGGTATTGAAGGAGATAAATCTCAGATCAGAGAATGGTTTGGA
GAGAACACACTTACTCAAATGGGGAATGGAGCAATCACCACTTTACATGGTGTGGCGGATTTAGCCTTAG
TTACATTCGATGCTCTGTTAGATACGGCAACGGCAACGGTTGCTTGCCCGATAGGCGAAGATGGGTTATG
TGAACAGGCAAATATAAATTTAAATGAAAAAGAACAGGCTTTATTTAATATTAGTAATTCATTGATAAAT
GGGCAAGCATGGGATGCACTTAAAAAAATGATAATGGATACAAATAATGGTGATCAGATTGCTCTGGAGC
ATTTTGCCAGCTTTTTATGGGGCTTTATGATACCCGCAAAAATACCAGAAGAAAATATCTCTGGGAAAGT
ATTTGTAGAGCCAGTAGTTTTAGAAGGTGGTGCTGGTGGCAATTGGACAGTATTTGATGAGGTTTTAGAT
TCAAATGTAATAAAGCAATTGACTTTAACAGGCTGTGGAGCGGCCTGTGGGGAAATGTTGCTTAGGGATA
GGTATATTTTTGTCACGCAAAATGTAATTGGAACAGAATTAACATCTATGACGTCGCTGGCAAACAAGCT
TAATAAATTTGATGTCGGCTGGGAAGGGAATGCAGTGAACGAATCTAGTTTATATGCCCTCAGTAATACT
GGTTCATGGGGAGCAATGATGTGGGATTCTGGAAGTAAAGTAGGGCATTGGGTACTTGTTAAGGGTGTTG
ATGATGCTGGGAATGTGATAATATATGATCCATATCAAGGGAGTCGATATCTGATGACTGAACAGGAATT
TAAGGAGGTATGGAATGGGCATAGTGTTTACAAACCATAA