SecReT6
Protein ID: 110642956
SecReT6 ID142
T6SS typei2
Gene symbol-
Locus tagECP_2801
StrainEscherichia coli 536
Repliconchromosome [GenBank: NC_008253] [Browse all T6SS(s) in this replicon]
Location [Strand]2942171..2943709 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ0TE44
KEGG IDecp:ECP_2801
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 6.30E-174, Aligned region: 88..508
Protein Sequence: 512 a.a.     [Download]
>gi|110642956|ref|YP_670686.1| hypothetical protein ECP_2801 [Escherichia coli 536]
MSVQQEHATSETATLTTTESGGVYQSLFDKINLTPVSSIQEIDLWQNSETLADASPDERVTAAIHVLLSC
LAKSGEDVVKLDKSLLDFHIDDLDQKISKQLDAVMHHPEFQKVESLWRGTWFVVQRTDFRKNVRIELLDI
SKEHLRQDFDDSPEIIQSGLYRHTYIQEYDTPGGEPVASLISSYEFDNSPQDIALLRNISRVSAASHMPF
IGSVGPKFFLKNSMEEVAAIKDIGNYFDRAEYIKWKSFRDTDDSRYVGLVMPRVLGRLPYGPDTVPVRSF
NYVEEVKGPDHEKYLWTNASFAFAANMVKSFVNNGWCVQIRGPQAGGAVADLPIHLYDLGTGNQVKIPSE
VMIPETREFEFANLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAHYL
KIIQRENIGSTKDRRVLELELNTWIRTLVTEMTDPGDELQASHPLRDGKVIVEDIEDNPGFFRVRLFAVP
HFQIEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1539 bp     [Download]
>gi|110640213|ref|NC_008253.1|:2942171-2943709 Escherichia coli 536, complete genome
ATGTCTGTACAACAAGAACATGCCACCTCTGAAACTGCAACACTCACCACCACTGAGTCCGGCGGCGTTT
ATCAGTCCCTGTTCGATAAAATTAATTTAACCCCGGTCTCTTCCATTCAGGAAATAGATTTATGGCAAAA
CAGCGAAACGCTGGCTGATGCCTCACCCGATGAGCGCGTGACGGCGGCGATTCACGTTCTGCTTTCCTGT
CTGGCGAAATCAGGCGAGGACGTGGTCAAGCTCGACAAGAGCCTGCTGGATTTTCATATCGACGATCTGG
ATCAGAAAATCAGTAAACAGCTTGATGCGGTCATGCACCACCCTGAATTCCAGAAAGTCGAGTCGCTGTG
GCGTGGTACATGGTTCGTCGTACAGCGCACTGATTTTCGCAAAAATGTCAGAATTGAATTGCTGGATATC
AGCAAAGAGCATCTGCGTCAGGATTTTGATGATTCACCGGAAATCATTCAGAGTGGTTTATATCGCCATA
CATACATTCAGGAATATGATACGCCGGGTGGCGAACCTGTAGCCTCATTAATATCCAGCTATGAATTTGA
TAACAGCCCGCAGGATATTGCCCTGCTGCGTAATATTTCCAGAGTGTCTGCCGCTTCCCATATGCCTTTT
ATCGGTTCTGTCGGGCCGAAATTCTTCCTTAAAAATTCGATGGAAGAAGTCGCCGCGATTAAAGATATCG
GCAACTACTTTGACCGCGCCGAATATATTAAATGGAAGTCGTTCCGCGATACCGATGACAGCCGCTACGT
GGGATTAGTGATGCCGCGCGTGCTGGGTCGTCTGCCCTATGGGCCGGACACGGTGCCGGTACGCAGCTTT
AACTATGTGGAAGAAGTCAAAGGCCCGGATCACGAAAAGTACCTGTGGACAAACGCCTCGTTCGCCTTTG
CCGCCAATATGGTGAAGAGCTTTGTGAATAATGGCTGGTGTGTGCAGATCCGTGGTCCACAGGCAGGTGG
CGCAGTGGCCGATCTGCCGATCCATCTTTACGATCTCGGCACCGGCAATCAGGTCAAAATTCCGTCCGAA
GTGATGATCCCGGAAACCCGCGAATTTGAATTTGCCAACCTTGGCTTTATTCCGCTCTCTTATTATAAGA
ATCGCGATTACGCCTGCTTCTTCTCGGCAAACTCCGCCCAGAAACCGGCGTTGTATGATACCGCTGACGC
CACTGCCAACAGTCGTATTAACGCCCGTTTGCCCTATATTTTCCTGCTGTCCCGCATTGCGCATTACCTG
AAAATTATTCAGCGCGAGAATATCGGCTCCACCAAAGACCGCCGCGTGCTGGAACTGGAGCTTAACACCT
GGATCCGCACGCTGGTGACGGAAATGACCGATCCGGGTGATGAACTGCAGGCGTCTCACCCGCTGCGCGA
CGGCAAGGTTATCGTGGAAGATATTGAGGACAATCCGGGCTTCTTCCGCGTCAGACTCTTTGCCGTGCCG
CATTTCCAGATCGAAGGGATGGACGTCAACCTGTCACTGGTTTCCCAGATGCCGAAAGCGAAAGCCTGA