SecReT6
Protein ID: 110642958
SecReT6 ID142
T6SS typei2
Gene symbol-
Locus tagECP_2803
StrainEscherichia coli 536
Repliconchromosome [GenBank: NC_008253] [Browse all T6SS(s) in this replicon]
Location [Strand]2945061..2945726 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ0TE42
KEGG IDecp:ECP_2803
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.10E-49, Aligned region: 8..208
Protein Sequence: 221 a.a.     [Download]
>gi|110642958|ref|YP_670688.1| hypothetical protein ECP_2803 [Escherichia coli 536]
MKKDMDINIDALLRDTFLTVVELRQGTTVRHGIELYRHCQRQVELVRERLKDAGFSRENVEHITYAQCAL
LDETVLSRSGMDDGQAIWMKNPLQSHFFNTLQAGELLYERMKQVLQEPAPAQAVLTCFHRVLLLGFRGRY
QDPAAPERDQLISTLNGQVAPFGVLPETAVLNVPLSTRQHPLLHSPFFWLVTLALLLAGVWWGLHHWLNV
LVDELLPQSLR
 
Nucleotide Sequence: 666 bp     [Download]
>gi|110640213|ref|NC_008253.1|:2945061-2945726 Escherichia coli 536, complete genome
ATGAAAAAAGATATGGATATCAATATCGATGCGCTGCTGCGCGACACGTTTCTGACGGTGGTGGAACTGC
GTCAGGGAACCACCGTGCGTCACGGTATCGAGCTGTATCGCCACTGTCAGCGGCAGGTGGAACTGGTCCG
CGAACGTCTGAAAGATGCCGGATTCAGTCGGGAGAACGTGGAGCACATAACTTACGCGCAGTGCGCCCTG
CTGGACGAAACGGTGCTCAGCCGTAGTGGCATGGACGACGGTCAGGCCATCTGGATGAAAAACCCACTCC
AGTCGCATTTCTTCAACACCCTGCAGGCCGGTGAGCTGCTGTACGAGCGGATGAAGCAGGTGCTACAGGA
ACCCGCCCCCGCGCAGGCCGTGCTGACCTGCTTTCACCGTGTCCTGCTGCTGGGATTTCGCGGGCGTTAT
CAGGATCCGGCAGCCCCGGAACGCGACCAGCTTATTTCGACGCTCAACGGGCAGGTCGCGCCATTTGGTG
TGCTGCCGGAAACGGCGGTACTGAACGTGCCGTTATCCACCCGTCAGCACCCTTTGCTGCATTCGCCATT
TTTCTGGCTGGTAACACTGGCGCTGCTACTGGCGGGCGTCTGGTGGGGGCTACACCACTGGCTGAATGTA
CTGGTGGATGAACTGCTGCCGCAAAGCCTGCGTTAA