SecReT6
Protein ID: 110642959
SecReT6 ID142
T6SS typei2
Gene symbol-
Locus tagECP_2804
StrainEscherichia coli 536
Repliconchromosome [GenBank: NC_008253] [Browse all T6SS(s) in this replicon]
Location [Strand]2945739..2947391 [+]
ProductOmpA family membrane protein
NoteTagL
UniProt IDQ0TE41, Q0TE41
KEGG IDecp:ECP_2804
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 4.60E-17, Aligned region: 437..533
Protein Sequence: 550 a.a.     [Download]
>gi|110642959|ref|YP_670689.1| OmpA family membrane protein [Escherichia coli 536]
MRNTLKQAIVLWGMVLLLVLWSVFISPSGVLRWAGAAAIVLAVAALLIYRRRQAWTEMTGDAGLSSLPPE
TYRQPVVLVCGGLSAHLFTDSPVRQVSEGLYLHVPDEEQLVAQVERLLTLRPAWASQLAVAYTIMPGIHR
DVAVLAGRLRRFAHSMATVRRRAGVNVPWLLWSGLSGSPLPERTNSPWFICTGGEVQVATSAETTTPAQW
IAQSGAQERSQRLCYLLKAESLMQWLNLNVLTALNGPEAKCPPLAMAVGLVTSLPAVDNNLWQVWITART
GLTTDIADTGTDATLPFPDALLRQLPRQSGFTPLRRACVTMLGITTAAGITMLCLSATANRQLLRQVGDD
LHRFYAVPVEEFITKARHLSVLKDNATMLDGYYREGEPLRLGLGLYPGERIRQPVLRAIRDWRPPEQKME
VTASLQVQTVRLDSMSLFDVGQARLKDGSTKVLVDALVNIRAKPGWLILVAGYTDATGDEKSNQQLSLRR
AEAVRNWMLQTSDIPATCFAVQGLGESQPAATNDTPQGRAVNRRVEISLVPRSDACQDVK
 
Nucleotide Sequence: 1653 bp     [Download]
>gi|110640213|ref|NC_008253.1|:2945739-2947391 Escherichia coli 536, complete genome
GTGAGGAACACGCTGAAACAGGCCATCGTGCTGTGGGGAATGGTGTTACTGCTGGTGCTGTGGTCAGTGT
TTATCAGTCCGTCTGGCGTGCTGAGATGGGCCGGTGCGGCGGCTATCGTTCTGGCGGTTGCTGCGTTGTT
GATTTATCGGCGCAGGCAGGCGTGGACGGAGATGACCGGCGATGCCGGGTTGTCATCGCTGCCGCCGGAA
ACCTACCGACAGCCGGTAGTGCTGGTCTGTGGCGGTCTGTCGGCGCACCTGTTCACTGACAGCCCGGTCC
GCCAGGTTTCAGAAGGGCTGTATCTGCATGTTCCTGATGAAGAACAGCTTGTGGCGCAGGTGGAGCGATT
GCTGACCCTTCGCCCGGCGTGGGCATCGCAGCTTGCCGTGGCGTATACCATCATGCCCGGCATACACCGG
GATGTGGCGGTTCTGGCCGGACGGCTGCGACGGTTCGCCCACAGTATGGCGACGGTGCGTCGTCGGGCAG
GCGTAAACGTCCCCTGGCTTCTCTGGAGCGGGCTGTCCGGCTCGCCGTTGCCGGAGAGAACGAATTCACC
GTGGTTTATCTGTACCGGCGGCGAAGTTCAGGTAGCAACATCCGCTGAGACCACCACGCCCGCGCAGTGG
ATTGCACAATCTGGCGCACAGGAACGCAGTCAGCGACTCTGTTACCTGCTGAAAGCTGAAAGCCTGATGC
AGTGGCTGAATCTTAATGTGCTGACGGCACTGAACGGCCCGGAGGCGAAATGCCCGCCACTGGCGATGGC
CGTGGGGCTGGTCACCTCGTTGCCAGCGGTGGATAACAACCTGTGGCAAGTGTGGATCACCGCCAGAACC
GGCCTGACGACGGATATCGCGGACACCGGCACAGACGCCACGCTGCCGTTTCCGGATGCTCTGTTACGGC
AGTTGCCGCGCCAGTCGGGCTTTACCCCGCTGCGGCGGGCCTGCGTGACCATGCTGGGCATTACCACCGC
GGCGGGTATCACCATGTTGTGCCTGTCAGCCACGGCAAATCGCCAGTTATTACGGCAGGTCGGTGACGAT
CTGCACCGGTTTTATGCCGTCCCGGTGGAGGAATTTATCACCAAAGCCCGTCACCTGTCGGTGCTGAAAG
ACAATGCGACCATGCTCGATGGGTATTACCGGGAAGGAGAACCACTGCGCCTCGGTCTGGGGTTATACCC
CGGCGAACGCATCCGCCAGCCGGTATTACGCGCCATTCGCGACTGGCGTCCGCCTGAACAAAAAATGGAG
GTGACGGCTTCGCTTCAGGTTCAGACCGTGCGTCTTGACAGTATGTCGCTGTTTGACGTCGGACAGGCCC
GCCTGAAAGACGGCTCGACAAAAGTGCTGGTGGATGCGCTGGTGAACATCCGGGCAAAACCGGGCTGGCT
GATCCTCGTGGCCGGATATACCGACGCCACCGGCGATGAAAAAAGCAATCAGCAGTTATCGCTGCGGCGT
GCCGAAGCGGTGCGCAACTGGATGCTGCAGACCAGCGACATCCCGGCCACCTGTTTTGCCGTACAGGGAC
TGGGCGAGAGCCAGCCTGCGGCGACCAACGACACGCCACAGGGCCGGGCAGTCAACCGGCGTGTCGAAAT
CAGTCTTGTTCCGCGTTCTGACGCCTGTCAGGACGTGAAATAA