SecReT6
Protein ID: 110642961
SecReT6 ID142
T6SS typei2
Gene symbol-
Locus tagECP_2806
StrainEscherichia coli 536
Repliconchromosome [GenBank: NC_008253] [Browse all T6SS(s) in this replicon]
Location [Strand]2948132..2950768 [+]
ProductCLPA/B-type chaperone protein
NoteTssH
UniProt IDQ0TE39
KEGG IDecp:ECP_2806
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.90E-40, Aligned region: 238..258
AAA_2 [PF07724], Evalue: 1.90E-40, Aligned region: 609..774
AAA [PF00004], Evalue: 4.50E-20, Aligned region: 22..57
AAA [PF00004], Evalue: 4.50E-20, Aligned region: 240..352
AAA [PF00004], Evalue: 4.50E-20, Aligned region: 614..738
AAA [PF00004], Evalue: 4.50E-20, Aligned region: 762..779
ClpB_D2-small [PF10431], Evalue: 1.10E-14, Aligned region: 780..855
AAA_5 [PF07728], Evalue: 2.00E-14, Aligned region: 240..264
AAA_5 [PF07728], Evalue: 2.00E-14, Aligned region: 613..732
AAA_16 [PF13191], Evalue: 2.00E-12, Aligned region: 166..201
AAA_16 [PF13191], Evalue: 2.00E-12, Aligned region: 217..262
AAA_16 [PF13191], Evalue: 2.00E-12, Aligned region: 285..318
AAA_16 [PF13191], Evalue: 2.00E-12, Aligned region: 486..559
AAA_16 [PF13191], Evalue: 2.00E-12, Aligned region: 596..649
AAA_16 [PF13191], Evalue: 2.00E-12, Aligned region: 678..707
AAA_16 [PF13191], Evalue: 2.00E-12, Aligned region: 753..805
AAA_22 [PF13401], Evalue: 6.20E-09, Aligned region: 239..325
AAA_22 [PF13401], Evalue: 6.20E-09, Aligned region: 480..514
AAA_22 [PF13401], Evalue: 6.20E-09, Aligned region: 610..650
AAA_25 [PF13481], Evalue: 9.80E-09, Aligned region: 240..300
AAA_25 [PF13481], Evalue: 9.80E-09, Aligned region: 609..642
AAA_19 [PF13245], Evalue: 5.80E-08, Aligned region: 237..262
AAA_19 [PF13245], Evalue: 5.80E-08, Aligned region: 609..635
Clp_N [PF02861], Evalue: 4.30E-07, Aligned region: 24..73
Clp_N [PF02861], Evalue: 4.30E-07, Aligned region: 108..124
Arch_ATPase [PF01637], Evalue: 5.30E-07, Aligned region: 218..389
Arch_ATPase [PF01637], Evalue: 5.30E-07, Aligned region: 606..626
Arch_ATPase [PF01637], Evalue: 5.30E-07, Aligned region: 682..695
NACHT [PF05729], Evalue: 2.10E-06, Aligned region: 112..135
NACHT [PF05729], Evalue: 2.10E-06, Aligned region: 240..332
NACHT [PF05729], Evalue: 2.10E-06, Aligned region: 613..637
AAA_17 [PF13207], Evalue: 2.20E-06, Aligned region: 240..342
AAA_17 [PF13207], Evalue: 2.20E-06, Aligned region: 612..648
IstB_IS21 [PF01695], Evalue: 2.60E-06, Aligned region: 234..301
IstB_IS21 [PF01695], Evalue: 2.60E-06, Aligned region: 498..531
IstB_IS21 [PF01695], Evalue: 2.60E-06, Aligned region: 613..632
AAA_14 [PF13173], Evalue: 3.30E-06, Aligned region: 240..337
AAA_14 [PF13173], Evalue: 3.30E-06, Aligned region: 611..695
Zeta_toxin [PF06414], Evalue: 6.00E-06, Aligned region: 233..267
Zeta_toxin [PF06414], Evalue: 6.00E-06, Aligned region: 604..653
Sigma54_activat [PF00158], Evalue: 1.20E-05, Aligned region: 224..254
Sigma54_activat [PF00158], Evalue: 1.20E-05, Aligned region: 612..730
Sigma54_activat [PF00158], Evalue: 1.20E-05, Aligned region: 763..815
AAA_18 [PF13238], Evalue: 0.00025, Aligned region: 240..278
AAA_18 [PF13238], Evalue: 0.00025, Aligned region: 614..638
AAA_29 [PF13555], Evalue: 0.0012, Aligned region: 234..256
AAA_29 [PF13555], Evalue: 0.0012, Aligned region: 609..624
ResIII [PF04851], Evalue: 0.0016, Aligned region: 185..262
ResIII [PF04851], Evalue: 0.0016, Aligned region: 308..322
ResIII [PF04851], Evalue: 0.0016, Aligned region: 613..635
RNA_helicase [PF00910], Evalue: 0.002, Aligned region: 241..262
RNA_helicase [PF00910], Evalue: 0.002, Aligned region: 614..635
AAA_24 [PF13479], Evalue: 0.0022, Aligned region: 240..255
AAA_24 [PF13479], Evalue: 0.0022, Aligned region: 614..635
T2SE [PF00437], Evalue: 0.003, Aligned region: 224..259
T2SE [PF00437], Evalue: 0.003, Aligned region: 610..691
AAA_33 [PF13671], Evalue: 0.0035, Aligned region: 240..257
AAA_33 [PF13671], Evalue: 0.0035, Aligned region: 487..504
AAA_33 [PF13671], Evalue: 0.0035, Aligned region: 612..646
DUF2075 [PF09848], Evalue: 0.0063, Aligned region: 242..342
DUF2075 [PF09848], Evalue: 0.0063, Aligned region: 501..532
DUF2075 [PF09848], Evalue: 0.0063, Aligned region: 612..635
Protein Sequence: 878 a.a.     [Download]
>gi|110642961|ref|YP_670691.1| CLPA/B-type chaperone protein [Escherichia coli 536]
MTGNHPAALLRRLNPYCARALDAAASLCQTRAHAEITIEHWLLKLLEQGEGDITVIARRYEWDIDTLWQS
LLAHLDTLPRPVRERPQLSEPLAALIRQAWLIASLEGDDPQIRSQHLLMALTEKPMLPACNDLWVLLSLS
RVQLERLRPLLDAQSDECPARQPQVTEPLTSALPETATADAPAKTLTEKQDDALLAVLNRFTEDVTEKAR
SGRIDPVFGRDTEIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLALRIAEGNVPDSLKTVHIRTLDLG
LLQAGAGVKGEFEQRLKNVIDAVQKSPEPVLLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIAA
TTWSEYKQYFERDAALERRFQMVKVDEPDDDTACLMLRGLKARYAQHHGVHMLDSAIQTAVRLSRRYLTG
RQLPDKAVDLLDTAGARVRMSLDTLPEPLTQLHARLAALDIEREAIEQDCVFYPEASPERLAELTDLRDE
LQAEAGHLEAQYQQEKALAQQIMTLRQEGTDSTELQQQLRTHQGFAPLLALDVDARAVATVVADWTGIPL
SSLLKDEQSDLLSMEKSLENRVVGQSPALCAIAQRLRAAKTGLTPENGPQGVFLLTGPSGTGKTETALTL
ADTLFGGEKSLITINLSEYQEPHTVSQLKGSPPGYVGYGQGGVLTEAVRKRPYSVVLLDEVEKAHRDVMN
LFYQVFDRGFMRDGEGREIDFRNTVILMTANLGSDHIMQLLEEKPDATDADLHELLYPLLRDHFQPALMA
RFQTVIYRPLGQEAMRAIVEMKLAQVARRLHQHYGLETEISNSLYDALTAACLLPDTGARNIDSLLNQQI
LPVLSQQLLAQQAVHHKPARLRLDWDDEDGIVLEFDEK
 
Nucleotide Sequence: 2637 bp     [Download]
>gi|110640213|ref|NC_008253.1|:2948132-2950768 Escherichia coli 536, complete genome
ATGACAGGAAATCACCCCGCCGCGCTGCTGCGTCGCCTTAACCCATACTGTGCACGGGCGCTGGACGCCG
CCGCCTCGCTGTGTCAGACCCGCGCCCATGCGGAAATAACCATTGAACACTGGCTGCTGAAACTGCTGGA
GCAGGGAGAAGGCGATATCACGGTGATTGCCCGCCGCTATGAATGGGATATCGACACGCTCTGGCAGTCT
CTGCTGGCACATCTGGACACCTTACCCCGCCCGGTCCGCGAACGTCCTCAACTTTCTGAACCGCTGGCAG
CGCTTATCCGACAGGCGTGGCTGATAGCGTCACTGGAAGGCGACGATCCACAAATCCGCAGCCAGCATCT
GCTGATGGCGCTGACAGAAAAACCGATGCTGCCCGCCTGTAATGACCTGTGGGTATTGCTGAGTCTGAGC
CGCGTGCAGCTTGAGCGGCTGCGTCCCCTGCTGGATGCGCAGTCGGATGAATGTCCGGCACGTCAGCCAC
AGGTCACCGAACCGCTGACCTCTGCACTGCCGGAGACGGCAACGGCGGACGCACCGGCAAAAACGCTGAC
GGAGAAACAGGATGACGCCCTGCTGGCGGTGCTTAACCGCTTTACCGAAGACGTGACGGAAAAAGCCCGC
AGCGGGCGAATCGACCCGGTATTCGGGCGCGACACGGAAATTCGCCAGATGGTCGATATCCTCTCCCGTC
GCCGCAAAAACAACCCGATTCTGGTGGGAGAACCGGGTGTTGGCAAAACCGCGCTGGTGGAAGGGCTGGC
GCTGCGTATCGCCGAAGGCAACGTGCCGGACAGCCTGAAAACGGTGCATATCCGCACGCTGGATTTGGGG
CTGTTGCAGGCCGGGGCGGGTGTTAAAGGTGAATTTGAACAGCGGCTGAAAAACGTGATTGACGCGGTGC
AGAAATCGCCGGAGCCGGTGCTGCTGTTTATTGATGAAGCCCATACCATTATCGGCGCGGGGAATCAGGC
AGGCGGCGCGGATGCGGCGAACCTGCTGAAACCGGCGCTGGCAAGGGGCGAACTGCGCACCATCGCCGCC
ACAACGTGGAGCGAATACAAACAGTATTTTGAGCGCGACGCCGCGCTGGAGCGCCGCTTCCAGATGGTGA
AAGTGGACGAGCCGGATGATGACACCGCCTGCCTGATGCTCAGGGGGCTGAAAGCCCGCTATGCGCAGCA
CCACGGCGTACATATGCTGGACAGCGCCATTCAGACCGCCGTGCGCCTGTCGCGCCGCTATCTGACCGGA
CGCCAGTTGCCGGACAAGGCGGTTGATTTGCTGGATACCGCCGGGGCAAGAGTCCGCATGAGCCTCGACA
CCCTGCCGGAACCGTTGACGCAGCTTCATGCGCGACTGGCGGCTCTGGATATTGAGCGGGAAGCGATTGA
GCAGGACTGCGTGTTTTATCCCGAAGCCAGCCCGGAGCGGCTGGCGGAACTGACCGATTTGCGTGATGAG
CTACAGGCAGAAGCCGGGCATCTGGAAGCGCAGTATCAGCAGGAAAAGGCACTGGCGCAGCAGATTATGA
CGTTGCGTCAGGAAGGGACAGACAGCACTGAACTGCAACAGCAACTGCGAACGCATCAGGGCTTTGCACC
GCTGCTGGCGCTGGATGTGGACGCCCGCGCCGTCGCCACGGTGGTGGCGGACTGGACCGGCATCCCGCTC
TCTTCCCTGCTCAAAGACGAGCAGAGCGACCTGCTCAGTATGGAAAAGAGCCTTGAAAACCGCGTGGTCG
GGCAAAGCCCGGCGCTCTGCGCCATCGCACAGCGGCTGCGGGCGGCTAAAACCGGCCTCACGCCGGAGAA
CGGCCCACAGGGGGTATTCCTGCTGACCGGCCCCAGCGGCACCGGTAAAACCGAAACTGCGCTCACACTG
GCCGACACCCTGTTTGGCGGTGAAAAATCCCTTATCACCATTAATCTTTCGGAATATCAGGAACCGCATA
CCGTTTCCCAGTTGAAAGGTTCGCCTCCGGGCTATGTCGGCTACGGTCAGGGCGGCGTGCTGACCGAAGC
GGTACGCAAACGCCCTTACAGCGTGGTGCTGCTCGACGAAGTGGAAAAGGCGCATCGCGACGTGATGAAC
CTGTTCTATCAGGTGTTCGACCGGGGCTTTATGCGCGACGGCGAAGGGCGGGAAATCGACTTCCGTAACA
CCGTGATTCTGATGACCGCCAATCTGGGCAGCGACCACATCATGCAGCTGCTGGAGGAAAAACCGGACGC
CACGGACGCAGACCTGCATGAACTGCTGTACCCCCTGCTGCGAGACCATTTTCAGCCTGCACTGATGGCG
CGCTTTCAGACGGTGATTTACCGCCCGCTGGGACAGGAGGCGATGCGCGCCATTGTGGAAATGAAACTGG
CGCAGGTGGCCCGCCGTCTTCACCAGCACTATGGGCTGGAAACGGAAATCAGTAACAGCCTGTACGACGC
CCTGACCGCCGCCTGCCTGCTGCCGGACACCGGTGCGCGTAATATCGACAGCCTGCTGAACCAGCAAATC
CTGCCGGTCTTAAGCCAGCAGTTGCTGGCGCAGCAGGCCGTGCATCATAAGCCTGCCCGACTGCGGCTTG
ACTGGGATGATGAAGACGGGATTGTGCTGGAATTTGATGAGAAATAA