SecReT6
Protein ID: 110642962
SecReT6 ID142
T6SS typei2
Gene symbol-
Locus tagECP_2807
StrainEscherichia coli 536
Repliconchromosome [GenBank: NC_008253] [Browse all T6SS(s) in this replicon]
Location [Strand]2950780..2953269 [+]
ProductVGR-related protein
NoteTssI
UniProt IDQ0TE38
KEGG IDecp:ECP_2807
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 9.30E-62, Aligned region: 30..347
DUF2345 [PF10106], Evalue: 9.00E-46, Aligned region: 602..743
T6SS_Vgr [PF13296], Evalue: 2.70E-34, Aligned region: 480..584
T6SS_Vgr [PF13296], Evalue: 2.70E-34, Aligned region: 581..608
Phage_base_V [PF04717], Evalue: 3.80E-14, Aligned region: 392..473
Protein Sequence: 829 a.a.     [Download]
>gi|110642962|ref|YP_670692.1| VGR-related protein [Escherichia coli 536]
MNVQFFDHAHHKLKIRGLQSPVDVLTFTGREQLSAPFRYDIEFTSTDKAIAPESVLMQDGAFSLSAPPVQ
GMPVMTPLRTLYGVITGFKHLSSSQDEARYEVRLEPRMALLARSRQNAIYQNQTVPQIVEKILRERHQMR
GQDFVFNLKSEYPAREQVMQYGEDDLTFVSRLLSEVGIWFRFATDARLKIEVIEFYDDQSGYERGLTLPL
RHPSGLFDGETEAVWGLNTAYSVVEKSVSTRDYNYREATAEMTTGQHDATGGDNTTYGEAYHYADNFLQQ
GDKEAAESGAFYARIRHERYLNEQAILKGQSTSSLLMPGLEIKVQGDDAPAVFRKGVLITGVTASAARDR
SYELTFTAIPYSERYGYRPALIPRPVMAGTLPARVTSTVKNDIYAHIDKDGRYRVNLDFDRDTWKPGYES
LWVRQSRPYAGDTYGLHLPLLAGTEVSIAFEEGNPDRPYIAGVKHDSAHTDHVTIQNYKRNVLRTPANNK
IRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAGKQQRGEGFELRTDLWGAVRAKKGIFISADAQDKAQGQ
VREMAPAMAILDGAQSQMKSLSTDAQTANADPADLSSQIALLQQSVKDLTQAAILLSAPKGVAIASGEHL
QLAASKNLIANAGNHADIGVVKNMFIGVGQALSVFVRKAGIRLFANKGAISVQAQNDLMELLAQKSIVIT
STEDEIKITAKKKITLNGGGSYIRLDACGIEAGTPGEYNVKAGYYGRKPKAKLTPELMAFPVISAKFDEQ
VRVIDDDGKFIANVPYYIEDSIGNIYKGFTDSAGCCERIFTEEADNLNVLLGIKALEKW
 
Nucleotide Sequence: 2490 bp     [Download]
>gi|110640213|ref|NC_008253.1|:2950780-2953269 Escherichia coli 536, complete genome
ATGAACGTACAGTTCTTCGACCACGCACACCACAAGCTCAAAATTCGCGGCCTGCAAAGTCCGGTGGACG
TGCTGACTTTTACAGGCCGCGAACAGCTCAGCGCCCCGTTCCGCTACGACATTGAGTTTACCAGTACCGA
TAAAGCCATCGCGCCGGAGTCGGTGCTGATGCAGGACGGCGCATTCAGCCTGAGCGCCCCGCCCGTACAG
GGAATGCCGGTGATGACGCCCCTGCGCACCCTGTACGGCGTCATTACCGGCTTTAAGCATCTCTCCTCGT
CACAGGACGAAGCCCGCTATGAAGTGCGTCTTGAACCCCGTATGGCGCTGCTGGCCCGCAGTCGCCAGAA
CGCCATTTACCAGAACCAGACGGTGCCGCAAATCGTCGAAAAAATCCTGCGCGAGCGGCACCAGATGCGC
GGTCAGGACTTCGTGTTTAACCTCAAAAGCGAATACCCGGCCCGCGAACAGGTGATGCAGTACGGTGAGG
ACGACCTGACGTTTGTTTCACGCCTGCTGTCAGAGGTGGGTATCTGGTTCCGCTTTGCCACCGACGCCCG
GTTGAAAATCGAAGTTATCGAATTTTACGACGACCAGAGCGGCTACGAGCGCGGGCTGACGCTGCCGCTT
CGCCATCCTTCTGGGCTGTTTGATGGTGAAACGGAAGCCGTATGGGGGCTGAACACCGCGTACAGCGTGG
TGGAAAAAAGTGTCTCCACGCGGGACTACAACTACCGTGAAGCCACGGCGGAAATGACCACAGGCCAGCA
TGACGCCACCGGGGGCGATAACACCACTTACGGCGAAGCCTACCACTATGCCGACAACTTCCTGCAACAA
GGCGATAAAGAGGCAGCGGAAAGCGGCGCGTTTTACGCCCGTATCCGCCACGAACGCTACCTGAATGAAC
AGGCCATTCTCAAAGGCCAGAGCACCAGTTCACTGCTGATGCCGGGGCTGGAGATAAAAGTTCAGGGCGA
CGACGCGCCTGCGGTGTTCCGCAAGGGCGTACTGATTACCGGCGTGACGGCCAGCGCGGCGCGTGACCGC
AGCTATGAACTGACGTTTACCGCTATCCCGTACTCAGAACGCTACGGCTACCGTCCGGCGCTAATCCCCC
GCCCGGTCATGGCCGGAACGCTCCCGGCGCGGGTCACCAGCACGGTGAAGAACGATATCTATGCCCATAT
CGACAAGGACGGGCGCTACCGGGTCAACCTCGACTTTGACCGCGATACGTGGAAACCGGGTTATGAAAGC
CTGTGGGTACGCCAGTCGCGCCCGTATGCGGGAGACACCTACGGCCTGCACCTGCCGCTGCTGGCGGGAA
CGGAGGTCAGCATCGCCTTTGAGGAAGGCAACCCGGACAGGCCGTATATCGCCGGGGTAAAACACGACTC
GGCGCACACCGACCATGTGACCATCCAGAACTACAAGCGCAACGTGCTGCGTACCCCGGCGAACAACAAA
ATCCGGCTGGATGACGAACGTGGCAAAGAGCATATCAAGGTCAGTACCGAGTACGGCGGCAAGAGCCAGC
TAAACCTCGGTCATCTGGTGGACGCCGGGAAACAGCAGCGCGGGGAAGGCTTTGAACTGCGTACTGATCT
GTGGGGTGCGGTGCGGGCAAAGAAAGGGATTTTTATCAGCGCCGACGCGCAGGACAAGGCGCAGGGTCAG
GTGCGCGAAATGGCTCCGGCGATGGCAATACTGGATGGCGCACAGTCACAGATGAAGTCGCTGTCCACTG
ATGCGCAGACGGCGAATGCCGATCCGGCAGATCTGTCATCACAGATAGCGCTGTTGCAGCAAAGTGTAAA
AGATCTGACTCAGGCTGCGATCCTGCTAAGCGCACCCAAAGGCGTGGCGATCGCCAGCGGAGAGCACCTG
CAACTGGCGGCATCGAAAAACCTGATCGCGAACGCAGGAAATCACGCTGATATCGGTGTTGTGAAGAATA
TGTTTATCGGTGTGGGTCAGGCGCTGAGCGTGTTTGTGCGCAAAGCGGGCATCAGGCTGTTTGCCAACAA
GGGGGCGATCTCGGTACAGGCACAGAACGATCTGATGGAACTGTTGGCACAGAAATCGATAGTGATCACC
AGTACGGAAGATGAGATCAAGATCACCGCGAAGAAGAAAATCACCCTAAACGGCGGTGGCAGCTACATCC
GGCTGGATGCCTGCGGGATAGAAGCTGGAACGCCGGGAGAATATAACGTTAAGGCGGGATATTATGGGCG
TAAGCCGAAGGCGAAGCTGACACCGGAACTGATGGCGTTTCCTGTAATATCTGCGAAATTTGATGAGCAA
GTTAGAGTAATTGATGATGACGGAAAATTCATTGCTAATGTACCTTACTATATAGAAGACAGCATAGGGA
ATATCTATAAGGGGTTTACTGATTCTGCCGGGTGCTGTGAAAGAATTTTCACGGAAGAAGCTGATAACCT
AAACGTACTTCTTGGTATTAAGGCGCTGGAAAAATGGTGA