SecReT6
Protein ID: 110642965
SecReT6 ID142
T6SS typei2
Gene symbol-
Locus tagECP_2810
StrainEscherichia coli 536
Repliconchromosome [GenBank: NC_008253] [Browse all T6SS(s) in this replicon]
Location [Strand]2954805..2957324 [+]
ProductVGR-related protein
NoteTssI
UniProt IDQ0TE35
KEGG IDecp:ECP_2810
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.00E-64, Aligned region: 33..350
DUF2345 [PF10106], Evalue: 2.60E-46, Aligned region: 605..746
T6SS_Vgr [PF13296], Evalue: 2.80E-34, Aligned region: 111..142
T6SS_Vgr [PF13296], Evalue: 2.80E-34, Aligned region: 483..587
T6SS_Vgr [PF13296], Evalue: 2.80E-34, Aligned region: 584..611
Phage_base_V [PF04717], Evalue: 4.00E-14, Aligned region: 395..476
Protein Sequence: 839 a.a.     [Download]
>gi|110642965|ref|YP_670695.1| VGR-related protein [Escherichia coli 536]
MMNIPALNFDHSHHKLKIRGLKSPVDVLTFTGREQLSAPFRYDIEFTSTDKTIEPESVLMQDGAFSLSAP
PVQGMPVQTALRTLHGIITGFKLLSSSRDEARYEVRLEPRMALLTRSRQNAIYQNLTVPQIVEKILRERH
QMRGQDFVFNLKSEYPSREQVMQYGEDDLTFISRLLSEVGIWFRFATDARLKIEVIEFYDDQSGYERGLT
LPLRHPSGLHDGATEAVWGLNTAYSVVEKSVTTRDYNYRTATAEMMTEQHDATGGDNTTYGEAYHYADNF
LQKGDKEAAESGAFYARIRHERYLNEQAILKGQSTSSLLMPGLEIKVQGDDAPAVFRKGVLITGVTASAA
RDRSYELTFTAIPYSERYGYRPALIPRPVMAGTLPARVTSTVKNDIYAHIDKDGRYRVNLDFDRDTWKPG
YESLWVRQSRPYAGDTYGLHLPLLAGTEVSIAFEEGNPDRPYIAGVKHDSAHTDHVTIQNDKRNVLRTPA
NNKIRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAGKQQRGEGFELRTDLWGAVRAKKGIFISADAQDKA
QGQVREMAPAMAILDGAQSQMKSLSTDAQTANADPADLSSQIALLQQSVKDLTQAAILLSAPKGVAIASG
EHLQLAASKNLIANAGNHADIGVVKNMFIGVGQALSVFVRKAGIKLFANKGAISVQAQNDLMELLAQKSI
EITSTEDEIKITAKKKITLNGGGSYIRLDACGIEAGTPGEYNVKAGYYGRKPKAKLTPELMAFPVIESGE
FNAKFLFTDDDGLPYANTKYIACFSDGTQKEGITDENGYTENFNTDSKQTIDVRLLNQNIDMILGGVHE
 
Nucleotide Sequence: 2520 bp     [Download]
>gi|110640213|ref|NC_008253.1|:2954805-2957324 Escherichia coli 536, complete genome
ATGATGAATATTCCTGCCCTAAACTTTGACCACTCACACCACAAGCTCAAAATTCGCGGCCTGAAAAGCC
CGGTGGACGTGCTGACGTTTACGGGCCGGGAACAACTCAGCGCACCCTTCCGCTACGACATTGAATTTAC
CAGTACCGATAAAACCATCGAGCCGGAGTCGGTGCTGATGCAGGATGGCGCATTCAGCCTGAGCGCCCCG
CCGGTACAGGGCATGCCGGTACAGACTGCCCTGCGCACCCTGCACGGCATCATCACCGGCTTTAAACTTC
TCTCCTCGTCACGCGACGAAGCCCGTTACGAAGTGCGTCTTGAACCCCGTATGGCGCTGCTTACCCGCAG
CCGTCAGAACGCCATTTACCAGAATCTGACGGTACCGCAAATCGTCGAAAAAATCCTGCGCGAGCGGCAC
CAGATGCGCGGTCAGGACTTCGTGTTTAACCTCAAAAGCGAATACCCGTCCCGTGAACAGGTGATGCAGT
ACGGTGAGGACGACCTGACGTTTATTTCACGCCTGCTGTCGGAAGTGGGTATCTGGTTCCGCTTTGCCAC
CGACGCCCGGCTGAAAATTGAGGTTATCGAGTTTTACGACGACCAGAGTGGCTATGAGCGCGGGCTGACG
TTGCCACTGCGCCATCCTTCAGGGCTACACGACGGAGCCACGGAAGCGGTATGGGGGCTGAACACCGCGT
ACAGCGTGGTGGAAAAAAGCGTCACCACGCGGGACTACAACTACCGCACCGCCACGGCGGAGATGATGAC
AGAGCAGCATGACGCCACCGGGGGCGATAACACCACCTACGGCGAAGCCTATCACTACGCCGACAACTTC
CTGCAAAAAGGCGATAAAGAGGCAGCGGAAAGCGGCGCGTTTTACGCCCGTATCCGCCACGAACGCTACC
TGAATGAACAGGCTATTCTCAAAGGTCAGAGCACCAGTTCACTGCTGATGCCGGGGCTGGAGATAAAAGT
TCAGGGCGACGACGCGCCAGCGGTGTTCCGCAAGGGCGTACTGATTACCGGCGTGACGGCCAGCGCGGCG
CGTGACCGCAGCTATGAACTGACGTTTACCGCTATTCCGTATTCAGAGCGCTATGGCTACCGCCCGGCGC
TTATCCCCCGCCCCGTAATGGCCGGCACGCTCCCGGCGCGGGTCACCAGCACGGTGAAGAACGATATCTA
TGCCCATATCGACAAGGACGGGCGCTACCGGGTCAACCTTGACTTTGACCGCGATACGTGGAAACCGGGT
TATGAAAGCCTGTGGGTGCGCCAGTCGCGCCCGTATGCGGGAGACACCTACGGCCTGCACTTGCCGCTGC
TGGCGGGAACGGAAGTGAGTATCGCCTTTGAGGAAGGCAACCCGGACAGGCCGTATATCGCCGGGGTAAA
GCACGACTCGGCGCACACCGACCATGTGACCATCCAGAACGACAAGCGCAACGTGCTGCGCACCCCTGCC
AACAACAAAATCCGGCTGGATGATGAGCGCGGCAAAGAGCATATCAAGGTCAGTACCGAGTACGGCGGCA
AGAGCCAGCTAAACCTCGGTCATCTGGTGGACGCCGGGAAACAGCAGCGCGGGGAAGGCTTTGAACTGCG
TACCGATCTGTGGGGCGCGGTGCGGGCAAAGAAAGGCATCTTTATCAGCGCCGACGCGCAGGACAAGGCG
CAGGGTCAGGTGCGCGAAATGGCTCCGGCGATGGCAATACTGGATGGCGCACAGTCACAGATGAAGTCGC
TGTCCACTGATGCGCAGACGGCGAATGCCGATCCGGCAGATCTGTCATCACAGATAGCGCTGTTGCAGCA
GAGTGTAAAAGATCTGACGCAGGCGGCGATCCTGCTAAGCGCCCCCAAGGGCGTGGCGATCGCCAGCGGC
GAGCACCTGCAACTGGCGGCATCGAAAAACCTGATCGCGAACGCAGGAAATCACGCTGACATCGGTGTTG
TGAAGAATATGTTTATCGGTGTGGGTCAGGCGCTGAGCGTGTTTGTACGCAAAGCGGGTATCAAACTGTT
TGCCAATAAAGGGGCGATCTCGGTACAGGCACAGAACGATCTGATGGAACTGTTGGCACAGAAATCGATA
GAGATCACCAGTACGGAAGATGAGATCAAGATCACCGCGAAGAAGAAAATCACCCTTAACGGCGGTGGCA
GCTACATCCGGCTGGATGCCTGCGGGATAGAAGCGGGAACGCCGGGAGAATATAACGTTAAGGCCGGATA
TTACGGGCGTAAACCAAAGGCGAAGCTGACGCCGGAGTTGATGGCGTTTCCAGTGATTGAGAGCGGGGAA
TTTAATGCTAAGTTCCTTTTTACTGATGATGATGGTCTACCTTATGCCAACACAAAATATATTGCATGTT
TTTCTGATGGCACTCAAAAAGAAGGTATTACTGATGAGAATGGGTATACAGAAAATTTTAATACTGATTC
CAAACAAACAATTGATGTCAGATTATTGAATCAAAATATAGACATGATATTGGGAGGCGTGCATGAGTAA