SecReT6
Protein ID: 110642970
SecReT6 ID142
T6SS typei2
Gene symbol-
Locus tagECP_2815
StrainEscherichia coli 536
Repliconchromosome [GenBank: NC_008253] [Browse all T6SS(s) in this replicon]
Location [Strand]2963930..2965567 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ0TE30
KEGG IDecp:ECP_2815
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.30E-20, Aligned region: 75..135
Protein Sequence: 545 a.a.     [Download]
>gi|110642970|ref|YP_670700.1| hypothetical protein ECP_2815 [Escherichia coli 536]
MRKNTEKTPMSELLQKLTRSCFADRDALDSARTQAALWQTWLLPVTADTPVGEDPGYHDDFLRIRDEMNK
LSGADTDLICQLAESLLLTQAKDVRIATYYIWARLHRDGERGLAEGLALLAGLVERFGAQLLPSRPASRK
MALEWLAGEKMLDSLARYPEVAKEDFANIVAALNQLTVSFTAWPEDQHSPSLMPLINALESRLAQSGGMN
AVVPQNSSGVPAPSSPVDAPQVQTITSGRDLLDQAKVLARYLNEQPQGWLSAHRLMKTLRWDTVHELPPD
VDGKTRLAPPRTESRNQLKRLYAQQNWTELLEQADLMFSSGVSHFWLDIQWYLHQALAKAGAPWDRWTAV
IRQDLAQLLERLPGLENLAWNDGTPFADEVTRNWIAQQVMMREDGAWLAGKAAVPTDDATNDVLALEPEA
LAMADSQGVEAALGWIQTRPGITTARQRLLLRLLMARVAEQYGKNEMALLLLEELDTAAQGITLTQWEPE
LLFEVKARQLKLLRLRAHRYADKALLNRKMEILLGTLVAIDPVRAAVLCDTQHKD
 
Nucleotide Sequence: 1638 bp     [Download]
>gi|110640213|ref|NC_008253.1|:2963930-2965567 Escherichia coli 536, complete genome
ATGCGGAAGAATACGGAGAAGACGCCGATGAGTGAACTGTTGCAAAAGCTGACCCGTAGTTGTTTTGCCG
ACCGGGACGCACTGGACTCGGCGCGAACACAGGCGGCACTGTGGCAGACGTGGCTGCTGCCGGTGACGGC
AGATACGCCGGTCGGGGAAGACCCCGGCTACCACGACGATTTCCTGCGTATCCGCGACGAAATGAACAAA
CTTTCCGGCGCGGATACGGACCTTATCTGCCAGCTTGCCGAATCCCTGCTGCTGACGCAGGCAAAAGACG
TGCGCATCGCCACTTACTACATCTGGGCGCGACTGCACCGCGATGGCGAACGCGGACTGGCTGAGGGGCT
GGCGCTGTTAGCCGGACTGGTGGAACGCTTCGGTGCGCAACTGCTGCCCTCGCGCCCGGCAAGCCGAAAA
ATGGCGCTGGAGTGGCTGGCAGGGGAAAAGATGCTCGACAGCCTTGCCCGCTACCCGGAAGTGGCAAAAG
AGGATTTTGCGAACATTGTTGCCGCTCTTAATCAACTGACGGTTTCCTTCACTGCATGGCCCGAAGACCA
GCATTCCCCCTCCCTGATGCCGCTGATTAACGCGCTGGAATCACGTCTGGCGCAGTCGGGTGGGATGAAC
GCGGTGGTGCCGCAGAACAGCAGCGGCGTTCCGGCACCGTCTTCCCCGGTGGATGCGCCACAGGTACAGA
CCATCACTTCCGGGCGCGACCTGCTCGACCAGGCGAAAGTGCTGGCCCGTTATCTGAACGAACAGCCGCA
GGGCTGGCTTTCAGCACACCGGCTGATGAAAACCCTGCGCTGGGACACGGTGCATGAACTGCCGCCGGAT
GTGGACGGAAAAACCCGGCTGGCCCCGCCGCGCACAGAATCACGCAACCAGCTTAAGCGGCTGTATGCTC
AGCAGAACTGGACGGAACTGCTGGAGCAGGCCGACCTGATGTTCAGCTCCGGCGTCAGCCATTTCTGGCT
GGATATCCAGTGGTATCTGCATCAGGCGCTGGCCAAGGCGGGCGCACCGTGGGACAGATGGACTGCGGTT
ATCCGTCAGGATCTGGCGCAGCTGCTGGAACGCCTGCCAGGGCTGGAAAATCTGGCATGGAACGACGGCA
CGCCGTTCGCCGATGAGGTGACGCGCAACTGGATAGCGCAGCAGGTCATGATGCGGGAAGACGGCGCATG
GCTTGCGGGGAAAGCCGCTGTACCGACAGACGACGCCACAAATGACGTACTGGCGCTGGAGCCGGAAGCA
CTGGCGATGGCAGACAGTCAGGGCGTGGAAGCGGCGCTGGGCTGGATACAGACCCGTCCGGGCATCACCA
CGGCACGACAGCGCCTGTTATTGCGGCTGCTGATGGCACGGGTGGCGGAACAGTACGGTAAAAACGAGAT
GGCGCTCCTGCTGCTGGAAGAACTGGATACCGCCGCACAGGGAATAACGCTGACGCAGTGGGAGCCAGAG
CTGCTGTTTGAGGTAAAAGCCCGACAGCTGAAACTGCTGCGTCTGCGGGCGCACCGCTATGCGGATAAAG
CCCTGCTGAACCGAAAAATGGAAATTCTGCTGGGAACGCTGGTGGCAATCGATCCGGTACGGGCAGCGGT
ACTGTGTGATACGCAACATAAGGACTGA