SecReT6
Protein ID: 110642971
SecReT6 ID142
T6SS typei2
Gene symbol-
Locus tagECP_2816
StrainEscherichia coli 536
Repliconchromosome [GenBank: NC_008253] [Browse all T6SS(s) in this replicon]
Location [Strand]2965573..2967003 [+]
Producthypothetical protein
NotePAAR
UniProt IDQ0TE29
KEGG IDecp:ECP_2816
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 3.10E-11, Aligned region: 9..66
FlgD_ig [PF13860], Evalue: 0.0095, Aligned region: 167..210
Protein Sequence: 476 a.a.     [Download]
>gi|110642971|ref|YP_670701.1| hypothetical protein ECP_2816 [Escherichia coli 536]
MGTGYFLVRGDKTTCGGKIIEGADDHTIMGIPQARDMDRVTCGRYPGMFIIVGGVPETDIHGRLMAGTLD
SQSSCPCKARFIASMMDDTYETDDGGNEPEQHAQSAKKDLTSGSDSSSDDVKLDYRIKLSGNKILTPLNI
PDYKEMISGGSTKNTEKIDFTITNKGDETEALSLEVLDGNEVIYSERQTGKYCDKGEHAWQWDGYSNQGI
LDTTKIKSKSLLVRLIALCGDMMIKVDYPLKTSANEEDWVDVKVDKNQKIVDVSWRVEFEDDGVSHKDDR
IAPVGFEKLKQLAKDGMEYYWARNGMRNPGIGNNITTPHGKYNVNISVSINIDPAMDSFDLIEEQDLESV
RSSAFMGRMNIYFNRGYYEYGRGYKKGADPVFKAGLEFKLDVAHETGHMILKSYGGNTYSWEHKGTSNLV
PPQYALPHSVYPGTGEIDLMKYYDGHIYTSDLYARSVAVENDVCAMIWLSRVKFHD
 
Nucleotide Sequence: 1431 bp     [Download]
>gi|110640213|ref|NC_008253.1|:2965573-2967003 Escherichia coli 536, complete genome
ATGGGAACAGGCTACTTTCTGGTCAGGGGGGACAAAACCACCTGCGGCGGCAAAATTATTGAAGGCGCGG
ACGACCATACGATCATGGGTATTCCGCAGGCACGGGATATGGACCGGGTCACCTGCGGCAGATATCCGGG
AATGTTTATTATTGTGGGTGGCGTTCCTGAAACAGATATTCACGGCAGGCTGATGGCGGGGACGCTGGAC
AGTCAGAGCAGTTGCCCGTGTAAAGCACGGTTTATTGCGTCAATGATGGATGATACCTATGAGACGGATG
ACGGGGGGAACGAGCCGGAACAACATGCGCAGTCGGCGAAAAAGGATCTGACTTCTGGTTCTGATTCATC
CTCTGATGATGTAAAACTGGATTACAGAATTAAATTATCAGGTAATAAGATACTGACGCCACTGAATATA
CCTGATTATAAAGAAATGATTAGCGGTGGTAGTACGAAGAATACAGAAAAAATAGATTTTACCATCACAA
ATAAAGGCGATGAGACTGAAGCGCTTTCTCTGGAAGTGCTTGATGGTAATGAAGTGATTTATAGTGAACG
GCAGACCGGTAAATATTGTGATAAGGGAGAGCATGCCTGGCAATGGGATGGTTACAGTAATCAAGGCATA
CTGGATACAACTAAGATAAAAAGCAAATCACTACTTGTAAGACTGATTGCTTTATGTGGTGATATGATGA
TAAAAGTTGATTATCCATTGAAAACTTCTGCGAATGAGGAAGATTGGGTTGATGTAAAAGTAGACAAGAA
TCAAAAAATAGTTGATGTCAGTTGGCGAGTAGAATTTGAAGATGATGGTGTGAGTCATAAAGATGATCGT
ATTGCACCTGTAGGGTTTGAAAAATTAAAGCAACTTGCCAAAGATGGAATGGAGTATTATTGGGCACGAA
ATGGAATGAGGAATCCCGGAATTGGCAATAATATTACTACTCCGCACGGTAAATATAATGTAAATATCTC
TGTATCAATAAATATTGACCCAGCCATGGATTCTTTTGATTTAATTGAGGAGCAAGATCTAGAAAGCGTC
AGGTCTAGTGCTTTTATGGGACGTATGAACATTTATTTCAATAGAGGGTATTATGAATATGGCCGTGGGT
ATAAGAAAGGCGCAGATCCTGTTTTTAAGGCTGGATTAGAATTTAAACTTGATGTAGCCCATGAGACTGG
TCATATGATATTAAAAAGTTACGGTGGGAATACGTATTCATGGGAGCATAAAGGGACCTCTAATCTTGTA
CCACCTCAATATGCACTGCCTCATTCAGTTTATCCAGGGACTGGCGAGATAGATTTAATGAAATATTATG
ATGGGCATATATACACCAGTGATCTATATGCAAGGTCGGTTGCTGTCGAAAACGATGTATGTGCAATGAT
ATGGTTATCTCGAGTGAAATTTCATGATTAG