SecReT6
Protein ID: 110642973
SecReT6 ID142
T6SS typei2
Gene symbol-
Locus tagECP_2818
StrainEscherichia coli 536
Repliconchromosome [GenBank: NC_008253] [Browse all T6SS(s) in this replicon]
Location [Strand]2967475..2967792 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ0TE27
KEGG IDecp:ECP_2818
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.10E-33, Aligned region: 6..77
Protein Sequence: 105 a.a.     [Download]
>gi|110642973|ref|YP_670703.1| hypothetical protein ECP_2818 [Escherichia coli 536]
MDDLTQRYYEAEMRYLREAGKEFAQAYPDRAAMLNLDKPGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTEGLVKPAVAALPANHPVAFRGRTDHGSPTNEAK
 
Nucleotide Sequence: 318 bp     [Download]
>gi|110640213|ref|NC_008253.1|:2967475-2967792 Escherichia coli 536, complete genome
ATGGACGACCTGACCCAACGCTACTATGAAGCCGAAATGCGCTACCTGCGTGAAGCGGGTAAAGAATTTG
CGCAGGCTTACCCCGACCGTGCTGCGATGCTTAATCTTGATAAACCCGGCGCACGCGATCCCTATGTGGA
GCGCCTGTTCGAGGGCTTCGCTTTTTTAATGGGCCGCCTGCGCGAAAAGCTGGACGACGACCTGCCCGAA
CTGACCGAGGGGCTGGTCAAGCCTGCTGTGGCCGCACTACCTGCGAACCATCCCGTCGCTTTCCGTGGTC
GAACTGACCACGGATCACCAACAAATGAAGCAAAGTGA