SecReT6
Protein ID: 110642974
SecReT6 ID142
T6SS typei2
Gene symbol-
Locus tagECP_2819
StrainEscherichia coli 536
Repliconchromosome [GenBank: NC_008253] [Browse all T6SS(s) in this replicon]
Location [Strand]2967749..2969236 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ0TE26
KEGG IDecp:ECP_2819
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.90E-136, Aligned region: 1..492
Protein Sequence: 495 a.a.     [Download]
>gi|110642974|ref|YP_670704.1| hypothetical protein ECP_2819 [Escherichia coli 536]
MVELTTDHQQMKQSDTLKEFQVLSRPIGERRTRCVYSATRDITLHPLALPDVSLQYEPDGRSVIRLRFAC
GPLVGDWSQIDLSRLPLYLNADSPVACALHRALTLGTQQFWLRLPGQERRVLDAHFSPMGFDDDDRLWPK
GESAFSGYQLLLEYFTFREKFMFVALNGLENVIWPERITGFEIDVVLAENWPHDLPFNTDNLRLHCVPVI
NLFPLEADPLHLSPLENEFLLRPMRIQDGHTEIYSVDNIISSRHTGSQAYVPFSSFRHRGGMLRHDAPER
YYHTRVKRGPSGLHDTWLILGGDAFDTDRMLEDETLSLNLTGTNGQLPRKALQSTLLDTPVHASQNVLRV
RNLCAPTQPCYPPARDRFHWRVLSHLGSNFLSMMDNAEILRGTLALYDWTESEMNRRRLEAIVDVQHSLI
QRFERGFLLRGVDIQVTLDSNGFAGEGDITLFGELLHRFFALYADIHLFTQLTLILQPTGKCLQWTEHHS
QRVPG
 
Nucleotide Sequence: 1488 bp     [Download]
>gi|110640213|ref|NC_008253.1|:2967749-2969236 Escherichia coli 536, complete genome
GTGGTCGAACTGACCACGGATCACCAACAAATGAAGCAAAGTGATACGCTGAAAGAGTTTCAGGTGCTAT
CCCGTCCCATCGGCGAACGCAGAACCCGCTGCGTCTACAGTGCCACGCGTGATATCACGCTGCATCCGCT
GGCGTTGCCGGACGTGTCATTGCAATATGAACCGGACGGACGCTCGGTTATCCGTCTGCGCTTTGCGTGC
GGCCCGCTGGTTGGTGACTGGTCGCAGATCGATTTATCCCGCCTGCCGCTCTATCTCAATGCCGACAGCC
CGGTAGCCTGTGCGTTGCACCGGGCTTTAACGCTTGGCACGCAGCAGTTCTGGCTGCGTCTGCCGGGGCA
GGAACGCCGTGTGCTGGACGCGCACTTTTCCCCGATGGGTTTTGATGACGATGACCGACTGTGGCCGAAA
GGTGAGTCAGCGTTCAGCGGCTACCAGTTGTTGCTGGAATATTTCACCTTCCGTGAGAAGTTTATGTTTG
TGGCGCTGAACGGGCTGGAGAACGTCATCTGGCCGGAAAGGATAACCGGCTTTGAGATTGACGTGGTGCT
GGCGGAAAACTGGCCTCATGATTTGCCGTTTAATACCGACAATCTCCGCCTGCACTGCGTGCCGGTCATC
AACCTGTTCCCGCTCGAAGCCGATCCGTTACACCTTTCGCCGCTGGAAAACGAATTTCTGCTGCGCCCGA
TGCGCATTCAGGACGGGCATACCGAGATTTATTCCGTCGACAACATTATTTCTTCGCGCCATACCGGCAG
TCAGGCGTATGTCCCCTTCTCCAGCTTTCGTCACCGGGGCGGGATGCTGCGCCACGATGCGCCGGAACGC
TATTACCACACGCGGGTAAAGCGCGGCCCTTCCGGCCTGCATGACACCTGGCTGATTCTGGGCGGCGATG
CGTTTGATACTGACCGGATGCTGGAGGATGAAACGCTCTCTTTAAACCTGACCGGTACTAACGGGCAGCT
TCCCCGTAAGGCTTTACAGAGCACGCTGCTCGATACGCCAGTTCATGCCTCACAGAACGTCCTGCGGGTG
CGCAACCTGTGCGCTCCGACGCAGCCCTGCTATCCCCCTGCGCGTGACCGCTTCCACTGGCGGGTGCTCA
GTCACCTTGGTTCTAACTTTTTATCGATGATGGATAACGCCGAAATTCTGCGCGGCACGCTGGCACTGTA
CGACTGGACCGAAAGCGAGATGAACCGCCGTCGTCTGGAGGCGATTGTCGACGTTCAGCACAGCCTGATA
CAGCGTTTTGAAAGAGGCTTTCTGCTGCGTGGCGTGGATATTCAGGTGACGCTGGACAGTAACGGCTTTG
CCGGAGAAGGTGATATCACGCTGTTTGGTGAACTGCTGCACCGCTTTTTCGCACTGTATGCCGATATCCA
CTTATTCACTCAACTGACCTTAATTCTGCAACCCACAGGAAAGTGCCTGCAATGGACAGAGCATCACAGC
CAGCGCGTACCGGGCTGA