SecReT6
Protein ID: 110642975
SecReT6 ID142
T6SS typei2
Gene symbol-
Locus tagECP_2820
StrainEscherichia coli 536
Repliconchromosome [GenBank: NC_008253] [Browse all T6SS(s) in this replicon]
Location [Strand]2969200..2970279 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ0TE25
KEGG IDecp:ECP_2820
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.20E-81, Aligned region: 19..319
Protein Sequence: 359 a.a.     [Download]
>gi|110642975|ref|YP_670705.1| hypothetical protein ECP_2820 [Escherichia coli 536]
MDRASQPARTGLTDRLAPDIARINFYRFCQLLEQSQQNAPLGSTDSPATDAVRFRPHPGMGFPVSELKNV
ERDVGNPDAPPTVRTTFLGLYGVDSPLPTAYLDYITQRHDGHDAVMAFLDIFNHRFITQYYRIWRKYNYP
ASFEAGAVDDISRCLLGLIGLGIPGSENHIATPVSRFLALLSVMRLPTRTAEGVTALVGLLAPLTKATVV
PHDPQPVILPAPAGLSKNSRISLKTRTLLGRTGTDVNSQLLLKLYTEDAAEARGWLPGGQLHSDLLVLLR
VYLGWRCQARLQLTLPVSLLPAARLGKQRVQISRTGILRASFAAPATGTVTVSLGRYQGLIPAFSIRNRE
SMTHVSYSF
 
Nucleotide Sequence: 1080 bp     [Download]
>gi|110640213|ref|NC_008253.1|:2969200-2970279 Escherichia coli 536, complete genome
ATGGACAGAGCATCACAGCCAGCGCGTACCGGGCTGACCGACCGGCTGGCCCCGGATATTGCGCGAATCA
ATTTTTACCGTTTTTGCCAGTTGCTGGAACAGAGCCAGCAGAACGCGCCGCTGGGCAGTACCGACAGCCC
CGCCACCGATGCGGTGCGCTTTCGTCCTCATCCAGGTATGGGCTTTCCGGTCAGCGAGTTAAAAAACGTT
GAACGTGACGTGGGCAATCCCGACGCGCCCCCCACGGTGCGCACCACTTTTCTCGGCCTGTACGGCGTGG
ATTCGCCGCTGCCAACCGCCTATCTGGACTACATTACCCAGCGTCATGACGGACATGACGCGGTGATGGC
GTTTCTCGATATTTTTAACCATCGCTTTATCACCCAGTATTACCGCATCTGGCGCAAATATAACTACCCG
GCGTCGTTTGAAGCAGGTGCCGTGGATGACATTTCCCGTTGTCTGCTGGGACTCATCGGGCTGGGTATTC
CCGGCAGCGAGAACCATATCGCCACGCCGGTATCCCGTTTTCTGGCCCTGCTCAGCGTGATGCGCCTGCC
GACGCGCACGGCGGAAGGCGTCACGGCACTGGTAGGGCTGCTTGCCCCGCTGACCAAAGCGACGGTGGTG
CCTCACGATCCGCAGCCTGTAATTCTCCCGGCCCCTGCGGGTCTGTCAAAAAATTCACGCATCAGCCTGA
AAACGCGAACGCTGCTGGGGCGTACCGGTACCGACGTCAACAGCCAGTTGCTGCTGAAACTGTATACCGA
AGATGCCGCAGAAGCACGTGGCTGGCTGCCCGGCGGGCAACTGCACAGCGATTTGCTGGTGCTGCTGCGC
GTTTATCTGGGCTGGCGCTGTCAGGCCCGTCTGCAACTGACGCTGCCCGTCAGCCTGTTGCCTGCTGCCA
GACTGGGAAAACAGCGTGTACAGATTAGCCGTACCGGCATCCTTCGCGCCTCCTTTGCCGCGCCCGCGAC
CGGAACAGTGACGGTCAGTCTGGGGCGTTATCAGGGATTAATACCCGCTTTTTCCATTCGTAACAGGGAG
AGTATGACTCATGTTTCCTATTCGTTTTAA