SecReT6
Protein ID: 110642976
SecReT6 ID142
T6SS typei2
Gene symbol-
Locus tagECP_2821
StrainEscherichia coli 536
Repliconchromosome [GenBank: NC_008253] [Browse all T6SS(s) in this replicon]
Location [Strand]2970260..2970796 [+]
Producthypothetical protein
NoteTssJ
UniProt IDQ0TE24
KEGG IDecp:ECP_2821
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 9.10E-36, Aligned region: 19..168
Protein Sequence: 178 a.a.     [Download]
>gi|110642976|ref|YP_670706.1| hypothetical protein ECP_2821 [Escherichia coli 536]
MFPIRFKRPALLCMAMLTVVLSGCGLIQKVVDESKSVASAVFYKQIKILHLDFFSRSALNTDAEDTPLST
MVHVWQLKTREDFDKADYDTLFMQEEKTLEKDVLAKHTVWVKPEGTASLNVPLDKETQFVAIIGQFYHPD
EKSDSWRLVIKRDELEADKPRSIELMRSDLRLLPLKDK
 
Nucleotide Sequence: 537 bp     [Download]
>gi|110640213|ref|NC_008253.1|:2970260-2970796 Escherichia coli 536, complete genome
ATGTTTCCTATTCGTTTTAAACGTCCGGCGCTGCTCTGTATGGCGATGCTGACGGTTGTTCTGAGCGGCT
GCGGGCTGATTCAGAAAGTGGTGGATGAATCGAAAAGCGTGGCCTCAGCCGTTTTCTACAAACAAATCAA
AATACTGCATCTCGATTTCTTCTCCCGCAGCGCCCTGAATACGGATGCGGAAGATACGCCGCTTTCCACG
ATGGTGCATGTCTGGCAACTGAAAACCCGCGAAGATTTTGACAAGGCGGATTACGACACCCTGTTTATGC
AGGAAGAGAAGACGCTGGAGAAGGACGTACTGGCAAAACACACCGTCTGGGTAAAACCGGAAGGCACGGC
ATCCCTGAATGTGCCGCTGGATAAAGAGACGCAGTTTGTCGCCATTATTGGGCAGTTTTATCACCCTGAT
GAAAAAAGCGACAGCTGGCGTCTGGTGATCAAAAGGGACGAACTGGAGGCCGACAAGCCGCGCTCGATTG
AACTGATGAGAAGCGACCTGCGACTGCTGCCTCTCAAGGATAAATAA