SecReT6
Protein ID: 110642977
SecReT6 ID142
T6SS typei2
Gene symbol-
Locus tagECP_2822
StrainEscherichia coli 536
Repliconchromosome [GenBank: NC_008253] [Browse all T6SS(s) in this replicon]
Location [Strand]2970800..2971228 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ0TE23
KEGG IDecp:ECP_2822
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.10E-17, Aligned region: 25..114
Protein Sequence: 142 a.a.     [Download]
>gi|110642977|ref|YP_670707.1| hypothetical protein ECP_2822 [Escherichia coli 536]
MATPSLYEMLTFSFSGELPLEQVSERDQLILSVMDNMQRIINCRAGTLAHLPDYGLPDLSLIHQGMAAGI
HSLMRQIEETLLRYEPRLNQIQVELLPQPRPGHLNYLIHAQLPDTGWIRFDGVFSPEGRIVLRHLKQQER
AY
 
Nucleotide Sequence: 429 bp     [Download]
>gi|110640213|ref|NC_008253.1|:2970800-2971228 Escherichia coli 536, complete genome
ATGGCGACACCTTCCTTATATGAAATGCTGACGTTCAGTTTCAGCGGCGAGTTACCGCTGGAACAGGTCA
GTGAGCGGGATCAGCTTATCCTTTCCGTGATGGACAATATGCAACGCATTATCAACTGTCGGGCAGGCAC
ACTGGCGCATTTGCCGGATTACGGTCTGCCGGATCTCAGCCTGATCCATCAGGGTATGGCTGCGGGTATT
CATAGCCTGATGCGCCAGATTGAAGAAACGCTGCTGCGTTATGAACCACGCCTGAATCAGATACAGGTGG
AGTTACTGCCCCAGCCCCGTCCGGGGCATCTTAATTACCTGATCCACGCGCAGCTTCCCGATACCGGCTG
GATACGCTTTGATGGCGTATTTTCTCCGGAAGGACGAATTGTTCTGCGTCATCTCAAACAGCAGGAGCGG
GCGTACTGA