SecReT6
Protein ID: 110642978
SecReT6 ID142
T6SS typei2
Gene symbol-
Locus tagECP_2823
StrainEscherichia coli 536
Repliconchromosome [GenBank: NC_008253] [Browse all T6SS(s) in this replicon]
Location [Strand]2971228..2972604 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ0TE22
KEGG IDecp:ECP_2823
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.40E-48, Aligned region: 119..124
DUF3702 [PF12486], Evalue: 2.40E-48, Aligned region: 306..449
ImpA-rel_N [PF06812], Evalue: 5.80E-17, Aligned region: 42..100
Protein Sequence: 458 a.a.     [Download]
>gi|110642978|ref|YP_670708.1| hypothetical protein ECP_2823 [Escherichia coli 536]
MASNANFISQFVMGGDPCTYKESGELQAEMSKLTHPARPDVDWRQVEKLSLALFRQNGVELQTLVCYVLA
ITRRQGLAGMADGLGSLDILLQRWADFWPVQVHSRISLLGWVTEKMQQALRTLDIQYQDLPQIYRCVQHL
SAIETTLQQCELWHMTKLDLLAGQFRNTALRLERLAPQGAETTITPPELPRREMNQPKKSEESPQPVFAT
RSVQQNDKDASPPVPSPEISRQRTWPIFMAGMVVMAGLGGTGLWGWSQLNQPDALIQRIQLSVMPLPLSL
ESGELAKLDVKDKALLAQDRTIAASQMQLEQLNKLPARWPLEQGYRQLRQLDALWPDNPQVRALNAQWRK
QRELSALSAEALNGYAQAQSQLQRLSAQLDALDERKGRYLTGSELKTAVYGIRQSLKEPPLEELLRQLEE
QKQTGEVSPTLLTQIDTRLNQLLNRYVILLDTKVEQSQ
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|110640213|ref|NC_008253.1|:2971228-2972604 Escherichia coli 536, complete genome
ATGGCAAGTAACGCGAATTTTATCAGCCAGTTCGTCATGGGCGGCGATCCCTGTACGTATAAGGAATCCG
GTGAACTGCAGGCTGAAATGAGTAAACTGACTCACCCGGCCCGGCCAGACGTGGACTGGCGCCAGGTGGA
AAAACTCAGCCTCGCGCTGTTCCGGCAAAATGGCGTGGAACTACAGACGCTGGTCTGTTACGTACTGGCG
ATAACCAGACGGCAGGGGCTGGCAGGGATGGCAGACGGACTCGGTTCACTGGATATACTGCTCCAGCGCT
GGGCTGACTTCTGGCCGGTACAGGTACATTCCAGAATATCACTGCTCGGCTGGGTCACAGAAAAAATGCA
GCAGGCACTGAGAACGCTGGATATTCAGTATCAGGATCTGCCGCAGATCTACCGTTGTGTACAGCATCTT
TCCGCCATCGAAACCACGCTGCAACAGTGTGAACTGTGGCATATGACGAAACTGGATCTACTGGCCGGGC
AGTTTCGCAATACCGCATTGCGTCTGGAACGGCTGGCGCCTCAGGGAGCGGAAACCACTATCACTCCCCC
TGAATTACCCCGCCGGGAAATGAATCAACCGAAAAAGTCAGAGGAAAGTCCACAGCCGGTTTTTGCAACC
AGATCCGTTCAGCAAAACGATAAGGATGCCAGTCCACCCGTTCCATCCCCTGAAATCTCCCGGCAGCGGA
CATGGCCGATATTTATGGCCGGAATGGTTGTGATGGCCGGTCTCGGCGGAACAGGATTATGGGGCTGGTC
GCAGCTTAATCAGCCGGACGCGCTAATCCAGCGAATACAACTGTCTGTCATGCCGTTGCCGCTGTCGCTG
GAGAGCGGCGAACTGGCAAAGCTGGATGTAAAGGATAAGGCGCTGCTGGCTCAGGACAGAACAATTGCGG
CAAGTCAGATGCAACTGGAGCAGTTAAACAAATTGCCTGCCCGCTGGCCACTGGAGCAGGGATATCGCCA
GCTACGCCAGCTTGATGCCCTGTGGCCGGATAATCCTCAGGTCAGGGCGCTGAACGCGCAGTGGCGCAAA
CAGCGGGAGCTGAGCGCCCTGTCTGCTGAGGCACTGAATGGCTATGCTCAGGCGCAGAGCCAGCTACAGC
GCCTGTCGGCGCAGCTGGATGCACTGGATGAACGTAAGGGGAGATATCTGACCGGTTCGGAACTAAAAAC
GGCGGTGTACGGCATCCGGCAGTCGTTAAAGGAGCCGCCGCTGGAAGAACTGCTTCGGCAACTGGAAGAG
CAAAAACAGACCGGAGAGGTTTCGCCAACGCTGTTGACGCAAATTGATACCCGGTTAAATCAGTTGTTGA
ATCGCTATGTCATTTTACTGGATACGAAGGTGGAACAAAGTCAGTAA