SecReT6
Protein ID: 110671181
SecReT6 ID469
T6SS typeii
Gene symbolpdpB2
Locus tagFTF1700
StrainFrancisella tularensis subsp. tularensis FSC198
Repliconchromosome [GenBank: NC_008245] [Browse all T6SS(s) in this replicon]
Location [Strand]1775568..1778849 [+]
Producthypothetical protein
NotePdpB
UniProt IDQ14FU0
KEGG IDftf:FTF1700, ftf:FTF1345
PDB IDNA
Domain hit(s) vs Pfam DUF1215 [PF06744], Evalue: 0.00056, Aligned region: 847..942
Protein Sequence: 1093 a.a.     [Download]
>gi|110671181|ref|YP_667738.1| hypothetical protein FTF1700 [Francisella tularensis subsp. tularensis FSC198]
MNFIKNHQILIISLTIAIIVLSVLGIFMIKKWLKTSRNPNKKSASKTIKNAKSLIKKNKVKNNLSELYIF
YGDYLAAKDYITKIKPQAQIIDNNELPLIAIDKNNTSLVFANNEFSYLYKLKKKLNLQFYKLNFCFDISN
DYYHENIKISEIYKELLKLRLKNFIISFYTLSEHTRSYNNAIDKKSIFKLTSDADTNHKAEEEILSKILS
SKDDVNNKYNNVKILNQIRRWLKNIHPQLKSINKETFFNFGLNTPDNIIAKKDTIFFSSSPKSIIINLIS
LLFSFIFIVNIFQEINIKEKFSIQELNQLHESDSNKIIEETRKKIDEAILLDILYPKSIKYHFIYEQYAD
TLLKNVILPKYNDTYDLSMITSFLIFFEYLDNKIINQHTNRILKIISSITNLSEKQLDIVIKYTTPSIRT
EMIKSAINRANKLYTNRLIVVGEDSESYLSTKGFNAEYLGISNTKRAKVINNIYIQYLYKCATDNAILDL
NDNYIIPIEVNNIFKMYQEQFDTSSKKLCNSSYINSITKSVSLILNQEENKRKFESFSDMLDHIYYLVKS
LEKNAKDVADDGKKQTSSITVSLINYVINSVVNPTYNKNELPLISPVSKNLYMEFAPNFYSKRILISPIY
SKEYIKDNIDPTNKKFNRLINNLKDNFNIEPDFMIAIYKSSINNYIEKYIGSYNKMIDSLNNDSEFNKNI
SNKGALKLYLLAMSSKDSSFNSLIEFYSTNTDLITNESETNSSKKINKLQHFYGEITKLNKQNNTNDQND
KSLWAPIDNYFKENDKYLESKSYADYKNIFKQLNNLIIEQGYSSTYKNIKQGYEPLQKVYSELSKINNHQ
GNNNLYKLLKKHLDIAINTIKTIAIQDAITKLDNTVNIEYEYINNQFPFNKDSNSAATNEAITKDFDNNG
YIYSGFIEQLSPLLSYNKTDDRWESKDFSKPEEIDYLNKFNKVYLLNKLLWDDKRNPKAIKFDITPIPNK
DNDYTFFSIILDKQNYVNSLNIKYSDSIEVLYNWNSLESTTITIKFEDGSNEQISYQGKWSILKAIKDAN
CDQNNICTWVIKHKGKKYPLSFKIESKFLQVLGWQKQGEVNVQ
 
Nucleotide Sequence: 3282 bp     [Download]
>gi|110669657|ref|NC_008245.1|:1775568-1778849 Francisella tularensis subsp. tularensis FSC198 chromosome, complete genome
ATGAATTTTATTAAAAATCATCAAATATTAATAATTTCACTAACTATAGCAATAATTGTTTTATCAGTAC
TTGGTATTTTTATGATTAAAAAATGGCTTAAAACATCAAGAAATCCTAACAAAAAATCTGCCTCAAAGAC
CATAAAAAATGCAAAATCATTGATCAAAAAGAATAAAGTAAAAAACAACTTAAGTGAATTGTATATTTTC
TATGGGGACTATCTGGCAGCTAAAGATTATATAACAAAGATAAAACCTCAAGCTCAAATCATTGATAATA
ATGAACTCCCTTTAATAGCTATTGATAAAAACAATACATCTCTCGTATTTGCAAATAATGAATTTTCGTA
CCTATATAAGTTAAAAAAGAAACTAAATCTACAATTTTATAAGCTTAACTTTTGCTTCGATATATCCAAT
GATTACTACCATGAAAATATCAAAATTAGTGAAATCTATAAAGAACTATTAAAATTAAGATTAAAAAACT
TCATAATATCTTTTTACACCTTATCTGAGCATACTAGAAGCTATAATAATGCAATTGATAAAAAATCAAT
ATTTAAATTAACTTCTGATGCGGATACAAATCATAAAGCTGAAGAGGAAATATTATCAAAAATTCTTAGC
TCTAAAGATGATGTTAATAATAAATACAATAATGTTAAGATATTAAATCAAATAAGAAGGTGGCTAAAAA
ACATCCACCCTCAATTAAAATCCATAAATAAAGAAACATTCTTTAATTTTGGGCTAAACACACCAGATAA
TATCATAGCCAAGAAAGATACAATATTTTTTAGCAGCTCTCCAAAAAGTATTATCATAAACTTAATATCT
TTGTTATTTAGTTTTATATTTATCGTTAATATTTTTCAAGAAATTAACATTAAAGAAAAATTCTCTATAC
AAGAGCTTAATCAACTACATGAAAGCGACTCTAATAAAATAATAGAAGAAACTAGAAAAAAAATTGATGA
GGCTATACTTCTAGATATCCTATATCCGAAATCGATAAAATATCATTTCATATACGAACAATATGCTGAT
ACTCTCCTAAAGAATGTAATCTTACCAAAATATAATGATACATATGACTTATCAATGATTACATCATTTT
TAATATTTTTTGAGTATTTGGATAACAAAATTATTAACCAACATACGAATAGAATACTTAAAATAATAAG
CAGTATCACCAACCTATCTGAAAAGCAGCTAGATATCGTGATCAAGTATACGACCCCAAGTATAAGAACT
GAAATGATTAAGTCAGCCATCAACAGAGCAAATAAACTTTATACAAATCGTTTAATAGTTGTAGGTGAAG
ACTCCGAAAGTTACTTAAGTACTAAAGGATTTAATGCTGAATACTTAGGGATTTCAAATACTAAAAGAGC
GAAGGTCATAAATAATATTTATATACAATACCTATATAAATGTGCTACAGATAATGCAATTTTAGATTTA
AACGATAACTACATAATACCAATAGAAGTAAATAATATCTTCAAGATGTATCAAGAGCAATTTGACACAT
CCTCTAAAAAGCTATGTAACTCATCATATATTAACTCTATTACAAAGAGCGTTTCTTTGATACTTAATCA
AGAGGAAAATAAAAGAAAATTTGAAAGCTTCAGTGATATGCTAGACCATATCTATTATTTAGTAAAATCA
TTAGAAAAAAATGCTAAAGATGTCGCAGATGATGGTAAAAAACAAACTAGCTCGATAACAGTATCGCTTA
TAAATTACGTTATAAATAGTGTTGTCAACCCTACTTATAATAAAAATGAGCTCCCACTAATAAGTCCAGT
AAGTAAAAACCTATATATGGAGTTTGCTCCTAATTTCTATAGTAAAAGAATACTTATCTCTCCAATATAC
TCAAAAGAATATATTAAAGATAATATAGATCCTACAAATAAAAAGTTTAATAGACTCATCAATAATCTAA
AGGATAACTTCAATATAGAACCCGACTTTATGATTGCTATCTATAAAAGTTCTATAAATAACTACATTGA
GAAATATATAGGATCCTATAATAAGATGATTGATAGCCTTAATAATGACTCTGAATTTAACAAAAATATA
TCTAACAAGGGTGCTCTTAAATTATATTTGCTAGCAATGTCATCAAAGGATTCTTCCTTTAATAGCCTAA
TAGAGTTTTATAGCACTAATACAGACCTAATAACTAATGAATCCGAAACCAATTCATCTAAAAAGATAAA
TAAGCTTCAACATTTTTATGGAGAAATAACTAAATTAAACAAACAAAACAATACTAATGATCAAAATGAT
AAGTCATTGTGGGCGCCTATAGATAACTACTTTAAAGAAAACGATAAATATCTTGAGTCTAAGAGTTATG
CCGACTATAAAAACATATTTAAACAGTTAAATAATCTAATAATAGAACAAGGCTATTCAAGTACATATAA
AAATATCAAACAAGGATATGAACCACTACAAAAAGTTTACTCTGAACTTTCTAAGATAAATAATCATCAA
GGTAATAATAACTTATATAAACTGTTGAAGAAACATCTAGATATTGCCATTAATACTATAAAAACTATCG
CCATACAAGATGCTATAACTAAACTTGATAATACTGTCAATATTGAGTACGAATACATAAATAATCAATT
CCCTTTTAATAAGGATAGTAACTCGGCTGCAACAAATGAAGCTATAACCAAAGACTTTGATAACAATGGT
TATATATACTCTGGATTTATAGAGCAACTATCTCCACTACTTTCTTATAATAAAACTGATGATAGATGGG
AAAGTAAAGATTTTTCAAAACCTGAGGAAATAGACTATCTAAATAAATTCAATAAGGTATATCTTTTAAA
TAAGCTACTATGGGATGATAAAAGAAATCCAAAAGCTATAAAATTTGATATAACTCCTATACCAAACAAA
GATAATGATTATACATTTTTTAGCATAATCCTCGATAAGCAAAACTATGTAAACTCATTAAACATAAAAT
ATTCAGATAGTATTGAAGTTTTGTACAACTGGAATTCACTTGAGTCAACAACTATTACCATAAAATTTGA
GGATGGTAGTAATGAGCAAATAAGCTATCAAGGAAAATGGTCTATATTAAAAGCAATTAAAGACGCAAAT
TGTGATCAAAACAATATTTGTACCTGGGTAATCAAGCACAAAGGTAAAAAATATCCTTTAAGCTTCAAAA
TAGAATCAAAATTCTTACAAGTATTAGGATGGCAAAAACAAGGAGAAGTCAATGTACAATAA