SecReT6
Protein ID: 110671182
SecReT6 ID469
T6SS typeii
Gene symbol-
Locus tagFTF1701
StrainFrancisella tularensis subsp. tularensis FSC198
Repliconchromosome [GenBank: NC_008245] [Browse all T6SS(s) in this replicon]
Location [Strand]1778839..1779216 [+]
Producthypothetical protein
NoteIglE
UniProt IDQ14FT9
KEGG IDftf:FTF1346, ftf:FTF1701
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 125 a.a.     [Download]
>gi|110671182|ref|YP_667739.1| hypothetical protein FTF1701 [Francisella tularensis subsp. tularensis FSC198]
MYNKLLKNFCLVLSTIIGLSSCISDGLYINNNIPKTKIVLESKPDKNIFYSDNYQSISQRIYDDNVKVLN
LKTGKNEFPLDKDIKDYALYFILPENKKTENWKYIISSDSVNKFTIKNDSSIEKD
 
Nucleotide Sequence: 378 bp     [Download]
>gi|110669657|ref|NC_008245.1|:1778839-1779216 Francisella tularensis subsp. tularensis FSC198 chromosome, complete genome
ATGTACAATAAATTATTGAAAAATTTTTGTTTAGTATTATCCACAATCATAGGGCTTAGCAGTTGTATTA
GTGATGGTTTGTATATCAACAACAATATTCCTAAGACAAAAATAGTTCTAGAATCTAAACCTGATAAAAA
TATTTTCTACTCAGATAACTATCAATCTATTTCTCAAAGAATATATGATGATAATGTAAAAGTATTAAAT
CTTAAAACAGGAAAGAATGAATTTCCATTAGATAAAGATATCAAGGATTATGCCTTGTATTTTATACTTC
CTGAAAATAAAAAAACTGAAAACTGGAAATACATAATAAGTTCAGATTCTGTAAATAAATTTACTATAAA
AAATGATAGTAGCATAGAAAAAGATTAA