SecReT6
Protein ID: 110671184
SecReT6 ID469
T6SS typeii
Gene symbol-
Locus tagFTF1703
StrainFrancisella tularensis subsp. tularensis FSC198
Repliconchromosome [GenBank: NC_008245] [Browse all T6SS(s) in this replicon]
Location [Strand]1779728..1781458 [+]
Producthypothetical protein
NoteIglF
UniProt IDQ14FT7
KEGG IDftf:FTF1348, ftf:FTF1703
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 576 a.a.     [Download]
>gi|110671184|ref|YP_667741.1| hypothetical protein FTF1703 [Francisella tularensis subsp. tularensis FSC198]
MNNNIDKWFENLFSNIHLYYKQEQSYKISKLNECITNVIKFINIKDYRKADIYNLTYVIEDVRYSTNLIL
SDSAIKFNDLILKKLDNLLDCTDINYFTSLMKNLKVLLEKYKLVIEKDISNRIELIKTKQIDKLESIFLD
YINNHSISAYDDSLVKLYVKTIQNPNSIEAIDEYKSYFDTLKIFIKDHKNIVSFIPFRKNPILSLLKLAY
LIRNGLYKTDRLLASDIILLRALYSINKDTYKLSLINEKTDTNLSIVSLTSLQAKPSENLKKTIDFIDLQ
IFAISQYFDDFPLQDIFFQKKSQIDIFKSESLEQLIFSLKSISNIMFDEETLYKKIHIKNQLYKNLFLNN
HNSLIEDIIEKSPANLLTKLANKYFQILLDIATIINIQLVSNNLKLIYPFLEFEKYFNQVTLEVSKKSQF
NQEKLEKNILNIIRIYPLLNQNYQLLKDMEQKIIDDKNSIESNDIYKLSVFVNSKSFSTYKEIRTLTSND
HKDINIHKSLAKLNKNICNAKHKNAAETAKELTIVLLSKSYYMNPTLIGVYNLPPISNSFFLVLKEITNN
PIIDSIKSKQEAYWKI
 
Nucleotide Sequence: 1731 bp     [Download]
>gi|110669657|ref|NC_008245.1|:1779728-1781458 Francisella tularensis subsp. tularensis FSC198 chromosome, complete genome
ATGAATAATAATATTGATAAATGGTTTGAGAATTTATTTAGCAATATCCATTTATATTATAAACAAGAGC
AATCTTATAAAATAAGTAAGCTTAATGAGTGCATCACTAACGTAATCAAATTTATAAATATAAAAGATTA
TAGAAAAGCTGACATCTATAATCTGACCTATGTTATTGAAGATGTAAGATACTCAACGAATCTAATTTTA
TCTGACTCTGCAATTAAATTTAATGATTTAATATTAAAAAAATTAGATAACCTCTTAGATTGTACTGACA
TTAACTATTTTACTAGCCTTATGAAGAATTTAAAGGTTCTTTTAGAAAAGTATAAACTAGTAATAGAGAA
AGATATATCGAATAGAATAGAACTTATAAAAACTAAGCAGATCGATAAACTAGAATCTATATTTTTAGAC
TATATAAACAACCATAGTATCAGCGCTTATGATGATAGTCTTGTAAAATTATATGTAAAAACTATACAAA
ATCCCAATTCCATTGAGGCTATAGATGAGTATAAATCATATTTCGATACGCTCAAAATATTTATAAAAGA
TCATAAAAATATAGTTAGTTTTATTCCCTTTAGAAAAAATCCTATTTTAAGCTTATTGAAATTAGCTTAT
TTAATTAGAAATGGTTTATATAAAACAGATCGTCTTTTAGCTAGCGATATTATTCTTTTAAGAGCTTTAT
ATTCTATAAATAAAGATACATATAAATTAAGTCTTATAAATGAAAAAACAGATACTAACCTATCAATAGT
TTCGCTGACGTCACTACAAGCTAAGCCCTCAGAAAACTTAAAAAAAACTATTGATTTTATAGATTTACAG
ATATTTGCTATATCTCAGTATTTTGATGATTTCCCTTTACAGGATATTTTTTTTCAAAAAAAATCACAAA
TAGACATTTTCAAGTCAGAATCACTAGAACAACTTATTTTCAGTTTAAAAAGTATTTCAAATATAATGTT
TGATGAAGAAACACTATATAAAAAAATCCATATAAAAAATCAACTCTACAAAAACCTTTTTTTAAATAAT
CACAATAGTTTGATAGAAGATATTATAGAAAAATCTCCAGCAAACTTATTAACAAAGCTAGCTAATAAAT
ACTTCCAAATACTGCTAGACATAGCAACAATAATAAATATTCAATTAGTAAGTAATAATTTAAAGCTTAT
TTATCCTTTCTTAGAGTTTGAAAAATATTTTAATCAAGTAACTTTAGAAGTATCAAAAAAATCACAGTTT
AATCAAGAAAAGCTAGAAAAGAATATTCTAAATATTATCAGGATATATCCTTTACTAAATCAAAACTACC
AATTATTAAAGGATATGGAACAAAAAATTATTGATGATAAAAATAGTATAGAATCAAACGATATATATAA
GCTTAGTGTTTTTGTAAATAGCAAAAGTTTTTCTACCTATAAAGAAATCAGAACCTTAACCTCAAATGAC
CATAAAGATATTAACATCCACAAATCTTTAGCAAAACTGAACAAAAATATTTGTAATGCCAAACATAAGA
ATGCCGCTGAAACAGCTAAAGAGCTAACGATAGTTCTTTTAAGTAAATCTTACTATATGAATCCAACTTT
GATAGGAGTATATAATCTACCGCCAATTTCAAATAGTTTTTTTTTGGTGCTTAAAGAGATTACAAATAAT
CCGATCATTGATAGTATAAAAAGCAAGCAAGAAGCTTATTGGAAAATTTAA