SecReT6
Protein ID: 110671186
SecReT6 ID469
T6SS typeii
Gene symbol-
Locus tagFTF1705
StrainFrancisella tularensis subsp. tularensis FSC198
Repliconchromosome [GenBank: NC_008245] [Browse all T6SS(s) in this replicon]
Location [Strand]1781993..1783423 [+]
Producthypothetical protein
NoteIglH
UniProt IDQ14FT5
KEGG IDftf:FTF1705, ftf:FTF1350
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 476 a.a.     [Download]
>gi|110671186|ref|YP_667743.1| hypothetical protein FTF1705 [Francisella tularensis subsp. tularensis FSC198]
MDEKRKDLSTNDASILKKTFDKLSNDIRDDFDKRIFDYSNALLFKYYSNLYYFIPKSCLLEISDKGHNGY
YIPPQEYFFIEDKRTGKTLTYTTKSENIILPIRDITTIKQSDTSINISLEFANNFDYDYVTIWIDPTLCK
EDPSFATYIFNQVLEDNGSAKIKFSNHSYTTKNVQIEPIKFQLKPTEKLVLNIHSPSLLYGFNIKIKDLF
KYKNNDLNKIDFFLEVKTENHNDEKLSSLFRVNLIPVFNSFDDYSSTSFASMNLSESKLKHHQKDDAQAI
EVLSVYENNKQCDFNSFLFVGQNEYYFNRSTQSLNYSSVLPQFSNKIIGTKIHTYTTWTQITEISDLIEI
NSNAIASISCNISPIVINKALNNYNSNAKEMFNIIDMIISKNMYSKTTLLAIAKLLKINTNDLTLLSMLL
QDVEMDSTINELILTLSDKYNPKYKHFLNFHIGIICKFINQNTFSFIKKIVLNNSI
 
Nucleotide Sequence: 1431 bp     [Download]
>gi|110669657|ref|NC_008245.1|:1781993-1783423 Francisella tularensis subsp. tularensis FSC198 chromosome, complete genome
ATGGATGAAAAAAGAAAAGATTTAAGTACGAATGATGCTAGCATCCTAAAAAAAACTTTTGACAAACTAA
GTAATGATATAAGAGATGATTTTGATAAGAGAATTTTTGATTATAGTAATGCTCTTTTATTCAAGTATTA
TAGTAACCTTTATTATTTCATTCCTAAATCATGCTTATTAGAAATAAGTGATAAAGGACACAATGGTTAC
TATATTCCGCCTCAGGAATATTTTTTCATAGAAGACAAGAGAACAGGTAAAACTCTAACATATACGACAA
AGTCAGAAAATATAATACTCCCTATTAGAGATATCACAACCATAAAACAAAGTGATACATCAATAAATAT
ATCATTGGAATTTGCAAATAACTTTGACTATGATTATGTTACTATCTGGATAGATCCAACTTTATGTAAA
GAAGATCCTAGCTTTGCCACATACATATTTAACCAAGTATTAGAAGATAATGGCTCAGCAAAGATTAAAT
TTTCAAATCATAGTTATACAACAAAAAATGTACAAATAGAACCAATTAAGTTCCAATTAAAACCAACAGA
AAAATTAGTTCTCAATATCCATTCTCCTAGCCTTTTATATGGTTTTAACATAAAGATCAAAGACTTATTT
AAATACAAAAATAATGACCTCAACAAAATTGACTTTTTTTTAGAAGTTAAAACTGAAAACCATAATGACG
AAAAATTATCATCTCTATTTAGAGTTAATTTAATACCTGTGTTTAATAGTTTTGATGATTACTCAAGCAC
CTCATTTGCTTCGATGAATCTCTCAGAGAGTAAACTAAAACATCATCAAAAAGATGATGCTCAAGCAATA
GAAGTATTATCTGTTTATGAGAATAATAAACAATGTGATTTTAATAGTTTTCTTTTTGTAGGACAGAATG
AGTATTATTTTAATCGCAGCACACAATCTTTAAATTATAGTAGCGTACTCCCTCAATTTAGTAATAAAAT
AATAGGAACAAAAATACATACATATACAACCTGGACACAGATAACTGAGATTTCTGATCTAATTGAAATT
AACTCAAATGCAATAGCATCTATAAGCTGTAATATTTCTCCAATAGTTATTAACAAAGCACTAAACAACT
ACAATAGCAATGCTAAAGAAATGTTTAATATAATAGATATGATCATCTCTAAGAATATGTATTCAAAAAC
AACACTCCTAGCTATAGCAAAGCTTTTAAAGATTAATACTAATGACTTAACTTTACTATCAATGCTCCTA
CAAGATGTTGAGATGGACTCTACTATAAATGAGCTAATTTTAACCTTAAGTGATAAATATAACCCAAAAT
ATAAACATTTCTTAAATTTTCATATTGGTATTATATGCAAATTTATAAATCAAAACACCTTTAGCTTTAT
TAAAAAGATTGTTTTAAATAACTCTATATAA