SecReT6
Protein ID: 110671189
SecReT6 ID469
T6SS typeii
Gene symbol-
Locus tagFTF1708
StrainFrancisella tularensis subsp. tularensis FSC198
Repliconchromosome [GenBank: NC_008245] [Browse all T6SS(s) in this replicon]
Location [Strand]1785198..1785971 [+]
Producthypothetical protein
NoteIglJ
UniProt IDQ14FT2
KEGG IDftf:FTF1708, ftf:FTF1353
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 257 a.a.     [Download]
>gi|110671189|ref|YP_667746.1| hypothetical protein FTF1708 [Francisella tularensis subsp. tularensis FSC198]
MKTILKIFLTYKQYWKILNMQHINNINKNISLNNFVSLLKSQKYSLKRINFIPVMINKTSSPTILDIYDN
KETLNVKINIFKIKPFTKLQSIYQEYIQNNNDLAIEILGYGLKVLLKLYILDTKALHKFTTKNSYYIQCA
PKYTIDNIINNIYKLLSEDYCTVIDYKEKLINIKRKQIVVGDSYVGKSFLGAYIPSYVYIINIKIYLISK
NQYVINKIKTQIKKIEEKITNLPFKIELEISIENNKKNQIYLGYFNL
 
Nucleotide Sequence: 774 bp     [Download]
>gi|110669657|ref|NC_008245.1|:1785198-1785971 Francisella tularensis subsp. tularensis FSC198 chromosome, complete genome
ATGAAGACTATTTTGAAGATCTTTTTGACATATAAACAATATTGGAAGATATTAAATATGCAACACATCA
ATAATATCAATAAAAATATCTCTCTAAATAACTTTGTAAGTCTTCTAAAAAGTCAGAAATATTCTTTGAA
AAGAATAAATTTCATACCGGTAATGATTAATAAAACCTCATCTCCTACCATATTAGATATTTATGATAAT
AAAGAAACTCTAAATGTAAAAATAAATATCTTTAAAATCAAACCATTCACTAAATTACAGAGTATTTATC
AAGAATATATCCAAAACAATAATGACTTGGCTATTGAGATACTTGGATACGGATTAAAAGTGCTACTAAA
GTTATACATTTTAGATACTAAAGCACTGCACAAATTCACAACAAAAAATAGTTATTATATTCAATGTGCT
CCCAAATACACTATAGATAACATAATAAACAATATCTATAAATTACTCTCGGAAGACTATTGCACAGTAA
TAGATTATAAAGAAAAACTAATCAATATAAAGAGAAAACAAATAGTAGTAGGAGATTCTTACGTTGGAAA
ATCTTTCTTGGGGGCATATATTCCCTCATATGTTTATATTATAAACATTAAGATATATCTCATTAGTAAA
AATCAATATGTCATAAATAAAATCAAAACTCAAATTAAAAAAATTGAGGAAAAAATTACAAATCTCCCAT
TTAAGATAGAACTTGAAATATCAATTGAAAATAATAAAAAAAATCAGATATACCTAGGTTATTTTAATTT
ATGA