SecReT6
Protein ID: 110671190
SecReT6 ID469
T6SS typeii
Gene symbolpdpC2
Locus tagFTF1709
StrainFrancisella tularensis subsp. tularensis FSC198
Repliconchromosome [GenBank: NC_008245] [Browse all T6SS(s) in this replicon]
Location [Strand]1786011..1789997 [+]
Producthypothetical protein
NotePdpC
UniProt IDQ14FT1
KEGG IDftf:FTF1354, ftf:FTF1709
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 1328 a.a.     [Download]
>gi|110671190|ref|YP_667747.1| hypothetical protein FTF1709 [Francisella tularensis subsp. tularensis FSC198]
MNDKYELNIYFEKIELPKTADFNMISKHDIKELRVDANLKKKIHLLQFDEDYLACMRRLRAIHPSKIAMQ
KIKSIRNKKNSFIIAILSLDKIIHKTKFITFGHKTVIFDFKKLWGLVDFVIVHTSNKTWVNHKLTSFMPS
ITYCNQNIIHLAYHSDFLYIYHTPEFMDDINVDRENRRELVAKIPDPYWVRADTKENKINITSEKKNLEK
DLKKITKLKNFEISANDIFFSKAIKAAPRLQHKNKSKLFNSLAIENNEKIKRDIIDYAISNAWYKNEGLL
ENLMTFLDALVVRHLYLIAVYSVYEIEIGIKSVKPEYSKLLKSGLLNKDIQNQLIYDQKKISNIIWLGET
FHGLDIEEAQALCEFLDEENINPKINPINSKKLYKTYKENYKSDSEKILSFTKYKEKYNFLNNDKLREEH
ANKLSSILEDPKFRVLSYINAFLCSTKNYLVPYGYLGSNPLTYYNCMLETGKRRTSKEAYFADIRNKLFI
VCYLPGFLSSVIADDDFIDWYSNKKENQELLKNSYLNNLYNSKQKYIKDFIDLDIIKLLKQTSSQIKPSY
IPVAFRYGAFASTTALIRSNANVSNRMEFELYDSPERLHNQYSEKEEMIMPKSVNNPKDHSIDNGMSLFS
LNLTNEKEDGLRKVMLKVAQLYNLDFKVGISGNLDQAMTQALILGMATTKKNGDIVIDEDQVLYMTYLYC
IFMAHSVDHTVDEILMSSNTYMLNSKEEKYPIANIANFFARPVFKLSKDKEFKALVEKYENSIKPNSKVL
KENYISRVTTLSEVYEDIYNLNCLYSSLSEGSLYNLLSTHSERNCTLLEQYSRKKKAETGLVQDGEKIKV
VNNYNSYAAINQYQHFVSLGIMYDSGAKYSYSHKKQIEKDFNLYSPDKEQINYLKYNFKDNKFDAVYKNK
KSKEKTQSHIVYAKKQNTRYCYGYFNDFFVKNRITTFYKIKDKSGNYLVNLHNEKYSFATPNSDSKIYRV
SPELLNNRDDFKRVSKDIIKSYKYISFDKQKEDIVKNFGKNLYHTNYEIWVGLSHQAISCFSVLDNIDTQ
EAANAFIDALYYIRLMQLYYGKTIPFLWISSEIVRYSSSETHYYIPTEENFENILKIALNRASKPVIERF
LIILNIYNNTIDDNTLILIRCRLTIILFEHEEQKLKLKALQKYADAYKKNNYKNEINFRAWFESIFHVQN
LSLSPNYIGNNILILSLVEELKPKCSEYKKNMINQQIIAKANELNFYQLLIRLIEISTYHRILTKSIITN
TTSLLYDILNKPEFQTINKLINKLFIYKNKDLNTDKYKAFHTKLITIEKTYKKINSLYKSDFFKKISS
 
Nucleotide Sequence: 3987 bp     [Download]
>gi|110669657|ref|NC_008245.1|:1786011-1789997 Francisella tularensis subsp. tularensis FSC198 chromosome, complete genome
ATGAACGACAAATATGAACTAAATATCTATTTTGAGAAAATAGAGTTACCTAAAACAGCAGATTTCAATA
TGATAAGTAAGCATGATATTAAAGAACTCAGAGTAGATGCTAATTTAAAAAAGAAAATACACTTATTACA
ATTTGATGAAGATTATTTAGCATGTATGAGGAGATTAAGAGCTATTCATCCCTCAAAAATAGCGATGCAA
AAAATTAAATCAATTCGCAATAAAAAAAATTCTTTTATAATTGCCATTTTATCTTTAGATAAAATAATTC
ACAAAACTAAATTTATCACTTTTGGACATAAAACCGTTATTTTTGATTTTAAGAAACTATGGGGATTAGT
TGATTTCGTAATAGTTCATACAAGTAATAAAACCTGGGTTAATCATAAGTTAACATCATTTATGCCATCA
ATTACATACTGTAATCAAAACATCATCCATTTAGCATACCATTCTGATTTTTTATATATTTATCATACTC
CAGAATTTATGGATGATATAAATGTAGATCGAGAAAATAGAAGAGAGTTAGTGGCAAAAATTCCCGATCC
ATATTGGGTAAGAGCTGATACTAAAGAAAATAAAATCAATATTACTTCTGAAAAGAAAAATCTAGAAAAA
GATTTAAAAAAAATAACTAAATTAAAAAATTTTGAAATAAGCGCAAATGATATTTTTTTCTCAAAAGCTA
TAAAAGCAGCTCCAAGATTACAACATAAAAATAAGAGTAAATTATTTAATTCATTAGCGATTGAAAATAA
TGAAAAAATCAAACGCGACATAATTGATTATGCAATATCTAATGCTTGGTATAAAAACGAGGGGTTACTT
GAAAATCTAATGACATTTTTAGACGCGCTAGTCGTAAGACATCTCTACTTAATAGCAGTTTACTCAGTTT
ATGAAATAGAAATAGGTATTAAATCAGTAAAACCTGAGTATAGCAAATTATTAAAATCTGGCCTATTGAA
CAAAGATATTCAAAATCAATTGATATATGATCAAAAGAAAATTAGCAATATTATTTGGCTTGGTGAAACA
TTTCATGGTTTAGATATTGAAGAAGCTCAGGCTTTATGTGAGTTTCTTGATGAAGAGAATATTAACCCGA
AAATTAATCCTATAAATTCTAAAAAGCTATATAAAACCTACAAAGAAAATTATAAAAGCGATTCAGAAAA
AATTTTAAGTTTCACAAAATACAAAGAGAAATATAATTTTTTAAATAATGATAAGCTTAGAGAAGAACAT
GCAAATAAACTTTCAAGCATATTAGAAGATCCAAAATTTAGAGTTCTTAGCTATATAAATGCATTTTTAT
GTTCAACTAAAAATTATCTAGTACCTTATGGGTATTTAGGAAGTAATCCTCTTACATACTATAATTGTAT
GCTAGAAACCGGAAAACGTAGAACATCAAAAGAAGCATATTTTGCTGATATAAGAAACAAATTGTTTATA
GTATGCTATCTTCCTGGCTTCTTGAGCTCTGTAATTGCTGATGATGACTTTATAGACTGGTATTCTAATA
AGAAAGAAAATCAAGAATTACTCAAAAACTCTTATTTGAACAATTTATATAATTCAAAGCAGAAATATAT
AAAAGATTTTATCGATCTTGATATTATTAAACTTCTAAAACAGACATCATCTCAAATCAAGCCAAGCTAT
ATACCAGTAGCTTTTAGATATGGTGCATTTGCCTCAACAACTGCTTTGATAAGATCAAATGCAAATGTTT
CTAATCGAATGGAGTTTGAATTATATGACTCACCTGAAAGACTACATAATCAATACTCAGAAAAAGAGGA
AATGATTATGCCAAAATCGGTTAATAACCCCAAGGATCACTCAATTGACAATGGAATGTCTTTATTTAGC
CTTAATCTAACAAATGAAAAAGAAGATGGACTTCGAAAAGTTATGTTGAAAGTTGCACAACTATATAATC
TTGATTTCAAGGTAGGTATCTCAGGAAATTTAGATCAAGCAATGACTCAGGCATTAATACTCGGGATGGC
AACTACAAAAAAAAATGGAGATATCGTAATTGATGAAGATCAAGTGCTATATATGACATACTTATACTGC
ATTTTCATGGCACATAGTGTCGATCATACTGTAGATGAAATACTAATGTCCTCAAATACTTATATGTTAA
ACTCTAAAGAGGAAAAGTATCCTATAGCCAATATAGCTAATTTTTTTGCTAGACCTGTATTTAAACTTTC
TAAGGATAAAGAGTTTAAAGCATTAGTTGAAAAGTATGAAAATAGCATAAAACCTAATTCAAAAGTTCTC
AAAGAAAATTATATAAGTAGAGTAACGACGTTATCCGAGGTATATGAAGATATATATAATTTAAATTGCT
TATATAGTTCTCTATCAGAAGGATCCTTGTATAACCTATTATCAACTCATAGTGAAAGAAACTGTACTTT
ATTAGAGCAGTATTCTCGTAAGAAGAAAGCGGAGACAGGATTGGTCCAAGATGGAGAGAAAATAAAAGTC
GTAAACAACTACAATAGCTATGCTGCGATTAATCAATATCAACATTTTGTATCACTAGGCATAATGTATG
ATAGTGGTGCAAAATACTCCTATTCTCATAAAAAACAGATAGAAAAAGATTTCAACTTATACTCACCAGA
TAAAGAACAGATAAATTATCTAAAATATAACTTTAAAGATAATAAATTTGATGCTGTTTATAAAAACAAA
AAGAGCAAAGAAAAAACTCAAAGCCATATTGTGTATGCAAAAAAACAAAATACGCGATATTGCTACGGAT
ATTTTAACGATTTTTTCGTTAAAAATAGAATTACGACTTTTTATAAAATAAAAGATAAATCAGGAAACTA
TTTAGTAAACTTACATAATGAAAAATATAGTTTCGCAACACCTAATTCAGATTCTAAAATATATAGAGTT
TCACCAGAATTACTTAACAATAGAGATGATTTTAAAAGAGTATCTAAAGATATTATAAAATCATATAAAT
ATATTAGTTTTGATAAACAAAAGGAAGATATAGTTAAAAATTTTGGTAAAAACTTATATCATACTAATTA
TGAGATATGGGTCGGACTATCACATCAAGCTATATCATGTTTTTCAGTTTTAGATAACATAGATACACAA
GAAGCTGCTAATGCTTTTATCGATGCTTTATATTATATTAGATTAATGCAATTATATTATGGCAAAACTA
TACCTTTTTTGTGGATTAGTAGCGAAATTGTAAGATATTCTTCATCAGAAACTCACTACTATATACCAAC
AGAAGAAAACTTTGAAAATATACTTAAAATTGCTCTTAATAGAGCCTCAAAACCAGTAATAGAAAGATTC
TTAATTATTCTTAACATATATAATAACACTATTGATGATAATACTTTAATTTTAATACGATGCCGTTTAA
CAATAATATTATTTGAACATGAAGAGCAGAAACTCAAATTAAAAGCTTTACAAAAATATGCTGACGCTTA
TAAAAAAAATAATTATAAAAACGAAATTAATTTTAGAGCTTGGTTTGAATCTATATTTCATGTTCAAAAC
TTATCCTTATCTCCTAATTATATTGGCAATAATATTTTAATCTTGAGTTTAGTTGAAGAATTAAAACCAA
AATGTAGTGAATATAAAAAAAACATGATTAACCAACAAATTATAGCTAAAGCAAACGAGTTAAACTTTTA
TCAACTTCTAATAAGACTTATTGAAATATCAACCTATCATAGAATACTTACGAAATCAATCATAACTAAT
ACAACCTCGTTACTTTATGACATATTAAATAAACCAGAATTTCAAACAATAAATAAATTAATAAATAAGC
TATTTATTTATAAAAACAAGGATCTAAATACTGATAAATATAAAGCCTTTCACACTAAGCTTATAACTAT
TGAAAAAACCTATAAGAAAATAAATAGCTTATATAAATCAGACTTTTTTAAAAAAATATCATCATAG