SecReT6
Protein ID: 110671191
SecReT6 ID469
T6SS typeii
Gene symbol-
Locus tagFTF1710
StrainFrancisella tularensis subsp. tularensis FSC198
Repliconchromosome [GenBank: NC_008245] [Browse all T6SS(s) in this replicon]
Location [Strand]1790015..1790590 [+]
Producthypothetical protein
NotePdpE
UniProt IDQ14FT0
KEGG IDftf:FTF1355, ftf:FTF1710
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 191 a.a.     [Download]
>gi|110671191|ref|YP_667748.1| hypothetical protein FTF1710 [Francisella tularensis subsp. tularensis FSC198]
MSKKIFKLLSISIIFSIYQQTFSNTIIASTFELKNSSKKNATIFLNLNEFCPTNIAACKDENDNNCIYIT
ELVREPLSRIYYYLAVPITSKSVKDLTILYKHDKEESPPEAINICLSLFKNNKHETYYSQVIYNWFVSSE
LYLSFSEGSIFINKDINNSNNYDKGNFLSVNLERIADGWAPPHYEKKITII
 
Nucleotide Sequence: 576 bp     [Download]
>gi|110669657|ref|NC_008245.1|:1790015-1790590 Francisella tularensis subsp. tularensis FSC198 chromosome, complete genome
ATGAGTAAAAAAATATTTAAATTATTATCAATTTCAATAATATTTAGTATATATCAACAAACATTTAGTA
ATACAATAATAGCTAGTACATTCGAACTAAAAAATAGTTCTAAAAAAAATGCTACTATCTTTCTAAATTT
GAACGAGTTCTGTCCGACTAATATAGCAGCATGCAAAGATGAGAATGACAATAATTGTATTTATATAACT
GAATTAGTTAGAGAACCTCTTAGTCGTATTTACTATTACTTAGCCGTGCCAATTACCAGCAAATCAGTTA
AAGACTTAACAATATTATATAAACATGATAAAGAAGAATCTCCACCAGAAGCAATAAATATATGTTTGAG
TTTATTTAAAAATAATAAGCATGAAACATACTATTCTCAAGTTATATATAATTGGTTTGTATCTTCAGAA
TTATATTTATCATTTAGTGAAGGATCTATTTTTATAAATAAAGATATTAATAATTCTAATAATTATGATA
AAGGTAATTTTCTAAGCGTAAATCTCGAACGTATAGCTGATGGCTGGGCCCCTCCTCATTATGAAAAGAA
AATTACTATAATATAA