SecReT6
Protein ID: 110671192
SecReT6 ID469
T6SS typeii
Gene symboliglD2
Locus tagFTF1711c
StrainFrancisella tularensis subsp. tularensis FSC198
Repliconchromosome [GenBank: NC_008245] [Browse all T6SS(s) in this replicon]
Location [Strand]1790597..1791802 [-]
Productintracellular growth locus, subunit D
NoteIglD
UniProt IDQ14FS9
KEGG IDftf:FTF1356c, ftf:FTF1711c
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 0.0028, Aligned region: 46..106
DUF876 [PF05936], Evalue: 0.0028, Aligned region: 188..348
Protein Sequence: 401 a.a.     [Download]
>gi|110671192|ref|YP_667749.1| intracellular growth locus, subunit D [Francisella tularensis subsp. tularensis FSC198]
MILMFLERIYWEDGLRLDSDILDKSNLSVLERLSTASYLPANLNKGIVSFDLDVESLQTGLILIKDLKLY
LDEKNFVFYDKSYPLSLQIMTDKLSDEIPLFLNIREKVIEKNGIKYIYNQLSLSLEHSYGFKHSIQIALF
RLDRGRLVPEIYDFPLLTLNHYYLGDIFVKLNRTVSELKSFNRFVFSASRSYASILLVFLINKLERELKF
AESNRANSYPKQIFDLIDDIYSLIQLNLDKVEELDSIEFDFQKPLTKLNLLADRLLTLCEYRKINNFIRF
ELHGKKYICESFPEEFFVATRYYLFLKRKATAPANVRFENKNALRITSISRNKNIVALSLSGVKLVDVEC
SMINFTTRFDNIDAIYEIQKGSEWDFILADSSAVFTAFEGSENFDFFIAFS
 
Nucleotide Sequence: 1206 bp     [Download]
>gi|110669657|ref|NC_008245.1|:c1791802-1790597 Francisella tularensis subsp. tularensis FSC198 chromosome, complete genome
TTGATTCTAATGTTTCTAGAAAGGATTTATTGGGAAGATGGTTTAAGATTAGATAGCGATATTTTAGATA
AGTCAAATCTATCTGTTTTAGAAAGGTTAAGCACCGCAAGCTATTTGCCAGCTAATCTTAATAAGGGAAT
CGTTAGCTTTGATTTAGATGTTGAAAGTTTGCAGACAGGTCTTATCCTTATAAAAGATCTTAAATTGTAC
TTAGATGAAAAAAATTTTGTTTTTTATGATAAGTCTTATCCGTTATCTTTACAAATAATGACTGATAAGT
TAAGTGATGAAATCCCCTTATTTCTGAATATCAGAGAGAAAGTAATTGAAAAAAATGGGATTAAATATAT
CTATAATCAATTGTCATTATCATTAGAGCATAGCTATGGTTTTAAACATAGCATCCAAATTGCATTATTT
AGGTTAGATAGAGGGCGATTAGTACCAGAAATTTATGACTTCCCGCTATTAACTCTTAATCATTATTATT
TAGGTGATATTTTTGTAAAACTTAATAGGACTGTTTCTGAACTAAAGTCTTTTAATCGCTTTGTTTTTTC
AGCTTCAAGATCTTATGCGTCAATATTACTTGTATTTTTGATTAATAAATTAGAAAGAGAATTGAAGTTC
GCAGAATCTAATAGGGCAAATAGTTACCCGAAACAAATATTTGATTTAATTGATGATATTTACAGCTTAA
TTCAACTTAACCTAGATAAAGTTGAAGAGCTTGATAGCATTGAATTTGATTTCCAAAAGCCTTTGACTAA
ATTAAATCTACTTGCTGATAGATTGTTAACTCTTTGTGAGTATAGAAAGATTAATAACTTTATCAGATTT
GAATTGCATGGAAAAAAATATATATGTGAAAGCTTTCCTGAAGAGTTTTTTGTTGCTACTAGATACTATC
TTTTCCTTAAAAGGAAAGCAACAGCTCCAGCCAATGTAAGGTTTGAAAATAAGAATGCTCTGAGAATTAC
TAGTATAAGTAGAAATAAGAATATTGTAGCTCTGTCTCTTTCAGGAGTAAAACTGGTTGACGTTGAATGT
TCTATGATTAATTTTACAACTAGATTTGATAATATCGATGCAATATATGAAATTCAAAAAGGTTCTGAGT
GGGATTTTATATTAGCGGATAGTAGTGCGGTTTTTACGGCTTTTGAAGGTAGTGAGAATTTTGATTTCTT
TATAGCCTTTTCTTAA