SecReT6
Protein ID: 110671193
SecReT6 ID469
T6SS typeii
Gene symboliglC2
Locus tagFTF1712c
StrainFrancisella tularensis subsp. tularensis FSC198
Repliconchromosome [GenBank: NC_008245] [Browse all T6SS(s) in this replicon]
Location [Strand]1791814..1792449 [-]
Productintracellular growth locus, subunit C
NoteIglC
UniProt IDQ14FS8
KEGG IDftf:FTF1357c, ftf:FTF1712c
PDB IDNA
Domain hit(s) vs Pfam IglC [PF11550], Evalue: 7.30E-143, Aligned region: 1..211
Protein Sequence: 211 a.a.     [Download]
>gi|110671193|ref|YP_667750.1| intracellular growth locus, subunit C [Francisella tularensis subsp. tularensis FSC198]
MIMSEMITRQQVTSGETIHVRTDPTACIGSHPNCRLFIDSLTIAGEKLDKNIVAIDGGEDVTKADSATAA
ASVIRLSITPGSINPTISITLGVLIKSNVRTKIEEKVSSILQASATDMKIKLGNSNKKQEYKTDEAWGIM
IDLSNLELYPISAKAFSISIEPTELMGVSKDGMRYHIISIDGLTTSQGSLPVCCAASTDKGVAKIGYIAA
A
 
Nucleotide Sequence: 636 bp     [Download]
>gi|110669657|ref|NC_008245.1|:c1792449-1791814 Francisella tularensis subsp. tularensis FSC198 chromosome, complete genome
ATGATTATGAGTGAGATGATAACAAGACAACAGGTAACAAGTGGCGAGACCATTCATGTGAGAACTGATC
CTACTGCATGTATAGGATCTCATCCTAATTGTAGATTATTTATTGATTCTTTAACTATAGCTGGGGAGAA
ACTTGATAAAAATATCGTTGCTATAGATGGTGGAGAGGATGTCACGAAAGCTGATTCGGCTACAGCTGCT
GCTAGTGTAATACGTTTATCTATAACGCCAGGCTCTATAAATCCAACAATAAGTATTACTCTTGGTGTTC
TAATTAAATCAAATGTTAGAACTAAAATTGAAGAGAAAGTTTCGAGTATATTACAAGCAAGTGCTACAGA
TATGAAAATTAAGTTAGGTAATTCTAATAAAAAACAAGAGTATAAAACTGATGAAGCATGGGGTATTATG
ATAGATCTATCTAATTTAGAGTTATATCCAATAAGTGCTAAGGCTTTTAGTATTAGTATAGAGCCAACAG
AACTTATGGGTGTTTCAAAAGATGGAATGAGATATCATATTATATCTATAGATGGTCTTACAACATCTCA
AGGAAGTTTGCCAGTATGTTGCGCAGCTAGCACAGATAAAGGAGTTGCTAAAATAGGATATATTGCAGCT
GCATAG