SecReT6
Protein ID: 110671194
SecReT6 ID469
T6SS typeii
Gene symboliglB2
Locus tagFTF1713c
StrainFrancisella tularensis subsp. tularensis FSC198
Repliconchromosome [GenBank: NC_008245] [Browse all T6SS(s) in this replicon]
Location [Strand]1792460..1794004 [-]
Productintracellular growth locus, subunit B
NoteIglB
UniProt IDQ14FS7
KEGG IDftf:FTF1713c, ftf:FTF1358c
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.30E-144, Aligned region: 81..505
Protein Sequence: 514 a.a.     [Download]
>gi|110671194|ref|YP_667751.1| intracellular growth locus, subunit B [Francisella tularensis subsp. tularensis FSC198]
MVSREDFIMTINKLSLTDELLNNFGGSTEVDSVLKNIDFDVSDDASKVLSLSTDYNARNLMALSLVLANN
DNINNYNQKYIQKVITVIDKLIDLQVNSIISNDEFRALEQEWLKVQEVCQEDYDNVEVSILDVKKEELQY
DFERNLYDISSSDFFKKVYVSEFDQYGGEPYGAILGLYNFENTTNDIIWLTGMGMVAKNSHAPFIASIDK
SFFGVKDLSEITHIKSFEALLEHPRYKEWNDFRNLDVAAYIGLTVGDFMLRQPYNPENNPVQYKLMEGFN
EFVDYDKNESYLWGPASIHLVKNMMRSYDKTRWFQYIRGVESGGYVKNLVACVYDNKGILETKSPLNVLF
ADYMELSLANIGLIPFVSEKGTSNACFFSVNSAKKVEEFVDGFDSANSRLIANLSYTMCISRISHYIKCV
IRDKIGSIVDVESIQKILSDWISEFVTTVYQPTPLEMARYPFRNVSIEVETIPGKPGWYSCKINVIPHIQ
FEGMNTTMTIDTRLEPELFGTNNN
 
Nucleotide Sequence: 1545 bp     [Download]
>gi|110669657|ref|NC_008245.1|:c1794004-1792460 Francisella tularensis subsp. tularensis FSC198 chromosome, complete genome
ATGGTAAGTAGGGAGGATTTTATTATGACAATAAATAAATTAAGTCTCACTGATGAACTTTTAAATAATT
TTGGGGGATCTACAGAAGTTGATAGTGTACTCAAAAATATAGATTTTGATGTTTCAGATGATGCTTCTAA
AGTTTTATCTTTATCTACTGACTACAATGCTAGAAACCTTATGGCGCTATCTTTGGTATTAGCAAATAAT
GATAATATAAATAATTATAATCAAAAATATATCCAGAAAGTTATTACAGTTATTGATAAGCTTATTGATT
TACAAGTTAATTCTATTATATCTAATGATGAGTTTAGAGCACTTGAGCAAGAATGGCTAAAGGTGCAAGA
GGTTTGTCAAGAAGACTATGATAATGTTGAAGTAAGTATATTAGATGTAAAAAAAGAAGAGCTACAATAT
GATTTCGAGAGAAATTTATATGATATATCTAGTAGTGACTTTTTCAAAAAAGTTTACGTTTCAGAATTTG
ATCAATATGGTGGCGAACCTTATGGCGCAATATTAGGATTGTATAATTTTGAAAATACCACAAATGATAT
AATTTGGTTGACTGGAATGGGTATGGTGGCAAAGAATTCTCATGCACCATTTATTGCATCAATTGATAAG
TCATTCTTTGGTGTTAAGGATTTATCAGAAATCACTCATATAAAAAGTTTTGAAGCTTTGCTTGAGCATC
CTAGATATAAAGAGTGGAATGATTTTAGAAACCTTGATGTTGCTGCATATATAGGTTTGACCGTAGGTGA
TTTTATGTTGCGGCAACCATATAATCCTGAGAATAATCCAGTTCAGTATAAACTTATGGAAGGCTTTAAT
GAGTTTGTTGATTATGATAAGAATGAAAGTTATCTATGGGGACCTGCTTCAATTCATCTAGTTAAGAATA
TGATGAGATCTTATGATAAAACTAGATGGTTCCAATATATAAGAGGAGTTGAGAGTGGTGGTTATGTAAA
GAACTTGGTAGCTTGCGTATATGATAATAAAGGCATTCTAGAAACTAAGTCACCTTTAAATGTATTATTC
GCTGATTATATGGAGTTATCACTTGCAAATATTGGTTTAATACCATTTGTAAGTGAAAAAGGTACTAGTA
ACGCTTGTTTCTTTAGTGTAAATTCTGCTAAAAAAGTCGAAGAATTTGTAGATGGATTTGACTCAGCAAA
CTCAAGATTAATTGCTAACCTTTCTTACACTATGTGTATATCGAGAATATCTCATTATATTAAATGTGTA
ATTAGAGATAAGATTGGTAGTATTGTGGATGTCGAGTCGATTCAAAAAATTCTTTCTGATTGGATATCAG
AATTTGTCACCACAGTCTATCAACCAACCCCTTTAGAAATGGCGAGATATCCTTTCAGAAACGTTTCTAT
CGAGGTTGAAACCATACCGGGTAAGCCTGGCTGGTATTCATGCAAAATAAATGTAATTCCCCACATTCAA
TTTGAAGGAATGAATACTACAATGACTATAGATACTAGGCTTGAACCAGAATTATTCGGTACAAATAATA
ACTAA