SecReT6
Protein ID: 110671195
SecReT6 ID469
T6SS typeii
Gene symboliglA2
Locus tagFTF1714c
StrainFrancisella tularensis subsp. tularensis FSC198
Repliconchromosome [GenBank: NC_008245] [Browse all T6SS(s) in this replicon]
Location [Strand]1793994..1794584 [-]
Productintracellular growth locus, subunit A
NoteIglA
UniProt IDQ14FS6
KEGG IDftf:FTF1714c, ftf:FTF1359c
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.20E-43, Aligned region: 16..168
Protein Sequence: 196 a.a.     [Download]
>gi|110671195|ref|YP_667752.1| intracellular growth locus, subunit A [Francisella tularensis subsp. tularensis FSC198]
MLIRCCEKKDNKMAKNKIPNSRLMINYETNVDGVLKKKELPYRVLVVGDLSKGRSVDAKKEFADREVRRV
NNGVDRVLEEMNISFDFEAPNFVSKDRSNLKVNYRIESVKDFRPDAVAKKVPEIRALLEMKEILASFAKD
IENNRNLKKTIDMIFSDSNELESLKSKIPALTNYTIKDSCDAAESQDLSNQQVDGK
 
Nucleotide Sequence: 591 bp     [Download]
>gi|110669657|ref|NC_008245.1|:c1794584-1793994 Francisella tularensis subsp. tularensis FSC198 chromosome, complete genome
TTGCTTATAAGGTGTTGTGAAAAAAAGGACAATAAGATGGCAAAAAATAAAATCCCAAATTCAAGGTTGA
TGATAAATTATGAAACTAATGTTGATGGTGTCTTAAAGAAAAAAGAGCTACCTTACAGAGTCCTAGTTGT
TGGCGATTTATCAAAAGGAAGATCTGTGGATGCAAAAAAAGAGTTCGCAGATAGAGAGGTCAGAAGAGTA
AATAATGGTGTTGATAGGGTTTTAGAAGAGATGAATATATCTTTTGATTTTGAGGCACCAAACTTTGTTT
CTAAAGATCGTAGTAATTTAAAAGTTAATTATAGAATTGAAAGTGTCAAAGATTTTAGACCTGATGCTGT
TGCTAAAAAAGTTCCTGAAATCAGAGCGCTGCTTGAAATGAAAGAGATATTAGCATCCTTTGCTAAGGAC
ATTGAAAATAATCGTAATCTCAAGAAAACCATAGATATGATTTTTTCAGATAGTAACGAATTAGAATCAT
TAAAGAGTAAGATTCCTGCTTTGACAAACTATACGATTAAAGACTCTTGTGATGCTGCTGAGTCTCAAGA
CTTAAGTAATCAACAAGTAGATGGTAAGTAG