SecReT6
Protein ID: 110671196
SecReT6 ID469
T6SS typeii
Gene symbolpdpD2
Locus tagFTF1715c
StrainFrancisella tularensis subsp. tularensis FSC198
Repliconchromosome [GenBank: NC_008245] [Browse all T6SS(s) in this replicon]
Location [Strand]1794629..1798216 [-]
Producthypothetical protein
NotePdpD
UniProt IDQ14FS5
KEGG IDftf:FTF1715c, ftf:FTF1360c
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 1195 a.a.     [Download]
>gi|110671196|ref|YP_667753.1| hypothetical protein FTF1715c [Francisella tularensis subsp. tularensis FSC198]
MDQDINDLLYDTNDLKKEKVCGGFFDFIKAWFYNDVERHMFFEDEIIVAQKLKTMDVMANTYALERKKYF
EKFLKDSHKQKGFFTRIKDRDFAFYKDPTRVKLWSSITDTDVYSFFIKSSVNQVLGGGNIAQLTSLPKFK
FNAIASVNNENISAAANLAATGAKSFFGSSCINIWSNLPVFDSERGDVKSFIPLYLRISGKASSALFNYN
IDISASTNRLKFTESKCMELLNNFKGNVNLRLVAAKSSREAKSFIYTPKFKEDSNKHLNDLGFILNTQQG
SYRYLVPEIRDGLDLIREYTYPEIEQIYFGRSALSGYSKSNYDKQSLGIEKNGEGLMTLRVSSKDYENPL
IQVKTSVNVTSFDLLSGQIKGKILADDLIGFSDAKGAINKFRNEVDTIIKNNISESFKSPFKIPNLSEFS
DMEIRVRFGLYSKQSASKLRTIRISIPMTTKMLDFNQTSGSYNTKSGMGYSMAQRHQLKEAIPYNEGLLE
NSAQQDFDLVKPTGNSTLGAVQDNLSNIYDKSSTFDSVIGSLRELYKLKGEDLTNIDSHDILNVLSQNSS
LSGLSSSIAADLNELNSKFKDITSINKKTSEAILSTNYQQYNPSFNKAKIFDNPDSFYVQDTLINYSQTL
KKEEFRDQMSTINIIEFGSDGDLPILFNLCKMMTSESAKDGAKNFLSQKENVNKTKEFFDALENTTSVIS
PESNISYTSINVLCSKNAGGVITENNKASSVSLGSTISLADFNRMYSLDSRVSVLGVSPLEELSSFSAKK
NEYKITFEEYFTKLAIQRYMEVIMIDDEADFIKSFVLPMMECQKKLLDNLVILNKDAKWKSSSSFKRAFS
NRGSFSFTGWLKERLPGFDFELSQEYAYFTGLVINFAFEEDNSSSETVIKLCKIIKSLDRLVRGFYFLLR
RMVKNRNTKVGSHNVSESHINMVKQILTSLCEPYQILTQKVSDNAELLSALVNMLSFMDSLVEVQRLCAS
ICIPTSAFFTLVNENKNLLKDICYTVEKSGVTGIVVESTFSYSPELFKENQQDIKLNIKNTSVRVRDGKV
KRVTSIDRNANTEAILQSIYDNIIAFDEQDLERLFTGFRILKQENSTNTNKAVFNIGLTYHPITNNAFVE
FNKDQQSLLYSYNNLSKDAYVTKIKSIVDAKVALNLSFEHEEIRSSQGFSVLATVPARGYSIDDLNRKYR
PMIWV
 
Nucleotide Sequence: 3588 bp     [Download]
>gi|110669657|ref|NC_008245.1|:c1798216-1794629 Francisella tularensis subsp. tularensis FSC198 chromosome, complete genome
ATGGATCAAGATATCAACGATTTATTATATGATACTAATGATTTGAAAAAAGAAAAAGTATGTGGCGGCT
TTTTTGATTTTATCAAAGCTTGGTTTTATAATGACGTTGAAAGACATATGTTTTTTGAAGATGAGATTAT
TGTGGCTCAGAAACTTAAAACGATGGATGTCATGGCTAATACATACGCCTTAGAGAGAAAAAAATATTTT
GAAAAATTTCTCAAAGATTCTCATAAACAAAAAGGTTTTTTTACAAGAATAAAAGATAGAGATTTTGCTT
TTTATAAAGATCCTACTAGGGTTAAACTATGGAGTAGTATTACTGATACTGATGTCTATAGCTTTTTTAT
AAAGTCAAGCGTTAACCAAGTGCTTGGTGGTGGTAATATAGCTCAACTGACATCATTACCAAAATTTAAG
TTTAATGCAATAGCATCAGTTAATAATGAAAACATCTCGGCAGCAGCTAATCTTGCAGCTACTGGAGCAA
AAAGTTTTTTTGGAAGTTCATGTATAAATATTTGGTCTAATTTACCTGTATTTGATAGTGAAAGAGGAGA
TGTTAAATCATTTATTCCATTATACCTAAGAATAAGTGGTAAAGCTTCATCGGCATTATTTAATTATAAT
ATAGATATAAGTGCTAGCACAAATAGATTAAAATTTACTGAATCAAAATGCATGGAATTATTAAATAACT
TTAAGGGCAATGTAAATCTTAGATTAGTGGCTGCAAAAAGCTCTAGAGAAGCAAAAAGCTTTATTTATAC
TCCAAAATTTAAAGAAGATAGTAATAAGCATTTAAATGATTTAGGTTTTATTCTAAATACTCAGCAAGGT
TCATATAGATATTTAGTTCCTGAAATTAGGGATGGACTTGATCTAATTAGAGAATATACATACCCCGAAA
TTGAACAGATTTATTTTGGTAGGAGTGCACTTTCTGGTTATTCAAAAAGTAATTATGACAAGCAAAGTTT
AGGTATTGAGAAAAATGGTGAGGGTCTTATGACTCTTAGGGTTAGTTCCAAAGATTATGAAAATCCACTA
ATTCAGGTCAAAACATCAGTTAATGTAACTAGTTTTGATCTTTTATCAGGACAAATAAAAGGTAAGATTT
TAGCTGATGACTTAATTGGTTTTTCAGATGCTAAAGGTGCTATTAATAAGTTCAGAAACGAAGTTGATAC
AATTATTAAAAACAATATTAGTGAAAGCTTTAAGTCTCCTTTTAAGATACCAAACTTATCTGAATTTAGT
GATATGGAGATAAGAGTGAGGTTTGGCTTATATTCTAAACAATCAGCATCCAAGTTGAGGACCATAAGAA
TCTCTATTCCTATGACTACTAAAATGTTAGATTTTAATCAAACATCTGGGTCATATAATACAAAATCAGG
TATGGGTTATTCAATGGCTCAGAGACATCAATTAAAAGAAGCAATACCTTATAATGAAGGTCTTCTAGAA
AATTCTGCTCAGCAGGATTTTGATTTGGTTAAACCAACCGGAAATAGTACTCTTGGAGCTGTGCAAGATA
ATTTATCAAACATATATGATAAAAGTAGTACGTTTGACTCAGTAATAGGTTCTTTGAGAGAGCTTTATAA
ACTTAAAGGTGAAGACCTAACAAATATTGATTCTCATGATATCCTTAATGTTTTATCACAAAACTCGTCT
TTATCAGGGTTATCTAGTAGTATCGCAGCAGATCTAAATGAGTTAAACTCTAAGTTTAAGGATATTACGT
CTATAAATAAAAAAACATCTGAAGCGATATTATCTACGAATTACCAGCAATATAATCCTAGTTTTAATAA
AGCAAAAATATTCGATAATCCAGATTCTTTCTATGTTCAAGATACTTTAATTAACTACTCACAAACCCTA
AAAAAAGAAGAATTTAGAGATCAGATGTCAACAATAAATATTATTGAATTTGGTAGTGATGGTGACTTAC
CTATATTATTTAATCTTTGTAAAATGATGACTAGCGAGTCAGCAAAAGATGGCGCAAAAAATTTTCTAAG
TCAAAAGGAGAATGTTAATAAGACTAAAGAGTTTTTTGATGCTCTAGAAAATACCACTTCTGTAATAAGT
CCAGAATCAAATATCAGTTATACATCTATTAATGTGCTTTGTAGCAAAAATGCTGGAGGTGTAATTACTG
AGAATAACAAAGCATCTTCTGTATCCCTAGGTTCAACTATTAGTTTAGCGGATTTTAATAGAATGTATTC
GCTTGACTCAAGAGTTTCTGTGCTTGGAGTATCTCCTTTAGAAGAGTTATCAAGTTTTTCAGCGAAAAAA
AATGAATATAAAATCACTTTTGAAGAATATTTTACTAAGTTAGCGATTCAAAGATATATGGAAGTTATTA
TGATAGATGATGAAGCTGACTTTATAAAATCATTTGTATTACCAATGATGGAGTGTCAAAAGAAACTATT
AGATAATTTAGTTATTCTAAATAAGGATGCTAAATGGAAAAGTAGTTCATCATTTAAGAGAGCTTTCTCA
AATAGAGGTAGTTTTAGTTTTACTGGTTGGCTTAAAGAGAGACTTCCTGGCTTTGATTTTGAGCTTTCTC
AGGAGTATGCTTATTTTACTGGCTTAGTAATAAACTTTGCCTTTGAAGAAGATAACTCTTCTTCTGAAAC
TGTAATTAAACTATGTAAAATTATAAAATCTTTAGATAGGCTTGTTCGAGGTTTTTATTTCTTACTAAGA
AGGATGGTGAAAAATAGAAATACTAAAGTTGGTTCTCATAATGTCTCTGAAAGTCACATTAATATGGTTA
AGCAGATTTTAACATCCTTATGTGAACCATATCAGATTTTAACTCAGAAGGTAAGCGATAATGCTGAACT
GTTGTCTGCTTTAGTTAATATGTTGAGTTTTATGGATAGCCTTGTTGAAGTACAGCGGCTATGTGCTTCG
ATTTGTATTCCAACCAGTGCATTTTTCACTTTAGTGAATGAAAATAAAAATTTGTTGAAAGATATTTGCT
ACACTGTCGAAAAAAGTGGTGTTACAGGAATAGTGGTTGAATCGACATTTAGCTATTCGCCAGAACTCTT
CAAAGAAAATCAACAAGATATTAAGCTTAACATTAAAAACACGTCAGTCAGAGTACGAGATGGTAAAGTC
AAGAGGGTTACCAGCATTGATAGGAATGCTAATACTGAAGCTATCTTACAAAGTATTTATGATAATATAA
TTGCGTTTGATGAACAAGATTTAGAAAGACTATTTACGGGGTTTAGGATTTTAAAACAAGAAAATTCGAC
AAACACTAATAAAGCCGTTTTCAATATTGGTTTAACATATCATCCAATAACTAATAATGCTTTTGTTGAA
TTTAATAAGGATCAACAAAGTTTATTGTACTCATATAATAATTTAAGCAAAGATGCGTATGTTACAAAAA
TTAAAAGTATAGTTGATGCTAAAGTTGCTTTAAACCTTAGTTTTGAACATGAAGAGATTAGAAGTTCACA
AGGTTTTAGTGTCTTAGCAACTGTACCAGCTAGAGGATATTCTATAGATGATTTAAATAGAAAGTATAGA
CCAATGATCTGGGTTTAA