SecReT6
Protein ID: 114319208
SecReT6 ID145
T6SS typei1
Gene symbol-
Locus tagMlg_0043
StrainAlkalilimnicola ehrlichii MLHE-1
Repliconchromosome [GenBank: NC_008340] [Browse all T6SS(s) in this replicon]
Location [Strand]47470..48432 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ0ACN6
KEGG IDaeh:Mlg_0043
PDB IDNA
Domain hit(s) vs Pfam Phage_base_V [PF04717], Evalue: 2.10E-24, Aligned region: 3..95
DUF2345 [PF10106], Evalue: 9.10E-06, Aligned region: 131..248
Protein Sequence: 320 a.a.     [Download]
>gi|114319208|ref|YP_740891.1| Rhs element Vgr protein [Alkalilimnicola ehrlichii MLHE-1]
MEGPQIARVVGPEGEAIHCDEHGRVKVRFPWDRYAADDEHASAWLRVAQPWAGPGYGGLFLPRVGHAVIV
DFLAGDPDQPVITGRVYDGHNTPPYPLPAHKTRSVLRSRSQDGEGYNELHFEDAREAERIHLHAQRDLDL
HTRNDRSETIGRHSHLGVHGDRLAEIHGDEHLTVQGERRERTGGDQHLSVEGTLHLKAGEAWLSECGREL
HVKSGHKAVIDAGAEITLQAGGSFIKVDPSGITLSGPGIRMNSGGSPGSGSGQAALAPEVPREAELASQR
EVEPAPNVPRIEPIRQEAALRQAMALTQPCTPTGDDEGSA
 
Nucleotide Sequence: 963 bp     [Download]
>gi|114319166|ref|NC_008340.1|:c48432-47470 Alkalilimnicola ehrlichii MLHE-1 chromosome, complete genome
ATGGAGGGCCCGCAGATCGCCCGGGTGGTGGGCCCCGAGGGGGAGGCGATCCATTGCGATGAGCACGGCC
GGGTCAAGGTCCGTTTCCCCTGGGACCGCTACGCCGCCGATGACGAGCACGCCAGCGCCTGGCTGCGCGT
CGCCCAGCCCTGGGCCGGGCCCGGCTACGGCGGGCTGTTCCTGCCCCGGGTGGGCCATGCGGTGATCGTC
GACTTCCTGGCCGGCGACCCGGATCAGCCGGTGATCACCGGCCGGGTCTACGATGGCCACAACACCCCGC
CCTATCCGCTGCCCGCGCACAAGACCCGCAGCGTGCTGCGCAGCCGCAGCCAGGACGGTGAGGGCTACAA
CGAACTGCACTTCGAGGATGCCCGCGAGGCCGAGCGCATCCACCTGCACGCCCAGCGCGATCTCGACCTG
CACACCCGCAACGACCGCTCCGAGACCATCGGCCGCCACAGCCACCTGGGCGTCCACGGCGACCGGCTCG
CGGAGATCCACGGCGACGAGCACCTCACCGTGCAGGGCGAGCGGCGCGAGCGCACCGGTGGGGATCAGCA
TCTCAGCGTGGAGGGCACCCTGCATCTCAAAGCCGGTGAGGCCTGGCTGAGCGAATGCGGCCGGGAACTG
CACGTCAAGTCGGGGCACAAGGCGGTCATCGACGCCGGTGCCGAGATCACCCTCCAGGCGGGCGGCAGTT
TCATCAAGGTCGATCCCTCGGGCATCACCCTCAGCGGCCCCGGCATCCGCATGAACTCCGGGGGCAGCCC
TGGATCGGGCTCGGGCCAGGCGGCCCTCGCACCGGAGGTGCCGCGGGAGGCGGAGTTGGCATCGCAAAGG
GAGGTGGAGCCGGCCCCTAACGTGCCGCGTATTGAGCCGATTCGGCAGGAGGCAGCCCTGCGCCAGGCGA
TGGCTTTGACACAGCCCTGCACACCCACTGGCGATGACGAGGGATCGGCATGA