SecReT6
Protein ID: 114319209
SecReT6 ID145
T6SS typei1
Gene symbol-
Locus tagMlg_0045
StrainAlkalilimnicola ehrlichii MLHE-1
Repliconchromosome [GenBank: NC_008340] [Browse all T6SS(s) in this replicon]
Location [Strand]49079..49588 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ0ACN5
KEGG IDaeh:Mlg_0045
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.80E-52, Aligned region: 6..159
Protein Sequence: 169 a.a.     [Download]
>gi|114319209|ref|YP_740892.1| hypothetical protein Mlg_0045 [Alkalilimnicola ehrlichii MLHE-1]
MSDQGTVAPRERINIRYVPATGDQASEAELPLKLLVVGDFKGGSEETPIEERTAVSVDKNNFHSVLAESG
LGLEACVPNRLQAGDEVSDLPVRLSFKALDDFAPDRLAQQVPELRKLVALREALVALKGPLGNIPAFRRQ
LQDLLESESVRERLLEELKRVTSPEDDTE
 
Nucleotide Sequence: 510 bp     [Download]
>gi|114319166|ref|NC_008340.1|:49079-49588 Alkalilimnicola ehrlichii MLHE-1 chromosome, complete genome
ATGTCCGACCAAGGAACGGTCGCGCCCAGAGAGCGCATCAATATCCGTTATGTGCCCGCCACCGGAGACC
AGGCGTCCGAGGCCGAGCTGCCACTGAAGCTGCTGGTGGTTGGCGACTTCAAGGGCGGTTCCGAGGAGAC
GCCGATCGAGGAGAGAACGGCGGTCTCCGTGGACAAGAACAACTTTCACTCCGTGCTCGCCGAGTCGGGC
CTGGGCCTGGAGGCCTGCGTGCCCAACCGGCTGCAGGCCGGTGACGAGGTCAGCGATCTGCCCGTCCGCC
TCTCCTTCAAGGCGCTGGATGACTTTGCCCCCGACCGGTTGGCACAGCAGGTGCCGGAACTCCGCAAGCT
GGTGGCCCTGCGTGAGGCCCTCGTGGCCCTGAAAGGGCCGCTGGGCAATATCCCGGCGTTCCGCAGGCAG
TTGCAGGACCTGCTGGAGAGCGAGTCGGTCCGGGAACGGTTGCTGGAGGAACTGAAGCGCGTCACGTCCC
CTGAGGACGACACCGAGTGA