SecReT6
Protein ID: 114319210
SecReT6 ID145
T6SS typei1
Gene symbol-
Locus tagMlg_0046
StrainAlkalilimnicola ehrlichii MLHE-1
Repliconchromosome [GenBank: NC_008340] [Browse all T6SS(s) in this replicon]
Location [Strand]49623..51101 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ0ACN4
KEGG IDaeh:Mlg_0046
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.70E-184, Aligned region: 65..490
Protein Sequence: 492 a.a.     [Download]
>gi|114319210|ref|YP_740893.1| hypothetical protein Mlg_0046 [Alkalilimnicola ehrlichii MLHE-1]
MNEMVAEHTASAASDGPLLDQIMAKTRMAPSDEGYDIARQGVAAFISELLKGEGEETPQVNKAVVDRMIV
ELDRKIGQQVDEILHLPEFQRLESAWRGLKLLVDRTDFRENIRLNLLHASKEELLEDFEFSPELPQSGLY
QHVYASGYGQFGGDPVAGVIGVYDFQPTTPDIKLLQYSAAVGATAHAPFISSVAPEFFGIERYQDLPNIK
DLAATLQGPKYARWRSLRESEDARYLGLTAPRFLLRMPYDPVENPVKTFNYRESVSESHEHYLWGNTAYL
FAERLTDSFARYRWCPNIIGPQSGGAVEHLPVHTFESMGQLQAKIPTEVLITDRREYELAEEGFIALTMR
KDSDNAAFFSANSVQRPRRFPNTAEGRAAETNFKLGTQLPYLFVVNRLAHYIKVLQREQIGAWKERQDLE
RELNDWIRQYVADQENPPAEVRSRRPLRAASIQVSDLEGDPGWYQVSLAVRPHFKYMGANFELSLVGRLD
KE
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|114319166|ref|NC_008340.1|:49623-51101 Alkalilimnicola ehrlichii MLHE-1 chromosome, complete genome
ATGAACGAAATGGTAGCCGAGCACACCGCGTCAGCGGCATCGGACGGCCCCCTGCTGGACCAGATCATGG
CCAAGACCCGCATGGCGCCCAGCGACGAGGGCTACGATATCGCCCGGCAGGGTGTTGCGGCCTTCATCAG
CGAGCTGCTCAAGGGTGAGGGGGAGGAGACGCCGCAGGTCAATAAAGCGGTGGTCGACCGGATGATCGTC
GAACTGGACCGCAAGATCGGGCAGCAGGTGGACGAGATCCTTCATCTGCCCGAATTCCAGCGCCTGGAGT
CCGCCTGGCGTGGCCTCAAGCTGTTGGTCGATCGCACGGACTTCCGCGAGAATATCCGCCTGAACCTCCT
CCATGCCAGCAAGGAGGAATTGCTGGAGGATTTCGAGTTCTCGCCGGAACTGCCCCAGAGCGGGTTGTAC
CAGCACGTCTACGCCTCCGGTTACGGTCAGTTCGGCGGCGACCCGGTGGCGGGGGTCATCGGGGTCTACG
ACTTCCAGCCCACCACCCCGGACATCAAGCTCCTCCAGTACAGCGCCGCCGTGGGGGCCACCGCCCACGC
CCCCTTCATCTCGTCGGTGGCCCCGGAGTTCTTCGGTATCGAGCGTTACCAGGACCTGCCCAACATCAAG
GACCTGGCCGCCACCCTTCAGGGGCCCAAATACGCCCGTTGGCGCAGCCTGCGTGAGAGCGAGGATGCCC
GATACCTCGGCCTCACGGCCCCGCGCTTTCTGCTGCGCATGCCCTACGACCCGGTGGAGAACCCGGTAAA
GACCTTCAACTACCGGGAGTCGGTCAGCGAGAGCCACGAGCACTACCTGTGGGGCAACACGGCCTATCTG
TTCGCCGAGCGGCTTACCGACAGCTTCGCGCGTTACCGCTGGTGCCCGAACATCATTGGCCCGCAGAGCG
GCGGTGCCGTGGAGCACCTGCCGGTGCATACCTTCGAGTCCATGGGCCAACTGCAGGCCAAGATCCCTAC
CGAGGTGCTGATCACCGACCGGCGGGAGTACGAACTGGCCGAGGAAGGGTTCATCGCCCTGACCATGCGC
AAGGACAGCGACAACGCCGCCTTCTTCTCGGCCAACTCGGTGCAGCGGCCCCGGCGCTTTCCCAACACGG
CGGAGGGCCGCGCGGCGGAGACCAACTTCAAGCTGGGCACGCAACTGCCCTATCTGTTCGTCGTCAATCG
CCTCGCCCACTACATCAAGGTGCTGCAGCGCGAGCAGATCGGTGCCTGGAAGGAGCGCCAGGACCTGGAG
CGGGAGCTGAACGACTGGATCCGGCAGTACGTGGCGGACCAGGAAAACCCGCCGGCGGAGGTGCGCAGCC
GGCGCCCCCTGCGCGCCGCCTCCATCCAGGTCTCCGACCTGGAGGGCGATCCGGGCTGGTATCAGGTCTC
GCTGGCCGTGCGTCCCCACTTCAAGTACATGGGGGCCAACTTCGAGCTCTCCCTTGTCGGTCGACTGGAC
AAGGAGTAA