SecReT6
Protein ID: 114319211
SecReT6 ID145
T6SS typei1
Gene symbol-
Locus tagMlg_0047
StrainAlkalilimnicola ehrlichii MLHE-1
Repliconchromosome [GenBank: NC_008340] [Browse all T6SS(s) in this replicon]
Location [Strand]51108..51536 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ0ACN3
KEGG IDaeh:Mlg_0047
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.40E-23, Aligned region: 34..126
Protein Sequence: 142 a.a.     [Download]
>gi|114319211|ref|YP_740894.1| hypothetical protein Mlg_0047 [Alkalilimnicola ehrlichii MLHE-1]
MALSRSYPRGPRLFERLGGLPLDPGPSAADGGVLIESIKAHLADLLNSHPGHCACAPGLGLVDFNDATLG
ALDLRLSIRRAVRDCIERYEPRIRQVSVEVMDQGSEPAALRFKLHAVLNTDRGDQRTTLDLMLSDRHYRF
ID
 
Nucleotide Sequence: 429 bp     [Download]
>gi|114319166|ref|NC_008340.1|:51108-51536 Alkalilimnicola ehrlichii MLHE-1 chromosome, complete genome
ATGGCGTTGTCCCGGTCCTATCCGAGGGGTCCCCGGCTTTTCGAGCGTCTGGGGGGGCTGCCGCTGGACC
CCGGCCCGTCCGCCGCCGACGGTGGTGTCCTGATCGAATCGATCAAGGCGCACCTGGCGGACCTGCTCAA
CAGCCACCCGGGGCACTGCGCCTGCGCCCCCGGGCTGGGCCTGGTGGACTTCAACGACGCCACCCTGGGG
GCGTTGGACCTGAGGTTAAGCATCCGGCGGGCTGTCCGCGACTGCATCGAGCGCTACGAGCCGCGTATCC
GCCAGGTGTCGGTGGAAGTGATGGATCAGGGCAGCGAGCCGGCCGCGCTGCGGTTCAAGCTCCACGCGGT
CCTCAACACCGATCGGGGAGACCAACGCACCACGCTGGACCTCATGCTCAGCGACCGTCATTACCGGTTC
ATCGACTGA