SecReT6
Protein ID: 114319212
SecReT6 ID145
T6SS typei1
Gene symbol-
Locus tagMlg_0048
StrainAlkalilimnicola ehrlichii MLHE-1
Repliconchromosome [GenBank: NC_008340] [Browse all T6SS(s) in this replicon]
Location [Strand]51556..53319 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ0ACN2
KEGG IDaeh:Mlg_0048
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.40E-211, Aligned region: 2..587
Protein Sequence: 587 a.a.     [Download]
>gi|114319212|ref|YP_740895.1| hypothetical protein Mlg_0048 [Alkalilimnicola ehrlichii MLHE-1]
MLNRYYRDELNFLRQEGRAFAQAYPHLSRFLSEPGDDPDVERLLEGFAFLTGRMREKVEDEFPELTHSLI
SMLWPNYLRPVPSMTIVRFDPRWHALRAGHRLPRGTALRSQPVQGTPCRFRTSHDVTLYPLEVAGVDTAR
SRSRSQVTLRLAVHSDQPLADLPADPLRFYLGGDGYTARTLYLWLQHYLEGVDLEVAGERRSLPADAISP
VGFERDQSLLPYPRNSFQGYRILQEYLCVPDAFRFLDLQRLSAALPHEAADEIRLVFRFSRTLPRDARLS
VDHFQLHCTPAVNLFEQDADPIDLTGERAEYPILPSSRNPAHYEVYSVDAVEGWLTTGSGRFRGEPRRYV
PFESFQHQLERDRGGDARYYRLRVRESVRDDGFAHDIAFVREDEVYRLAHHETVSLRLTCTNRRLPESLG
VGDITDFADDSPALVTARNITRPTPALRPQLDGGLLWTLISNLALNYLSLLHTDALRSVLRAYDFRALVD
RQAERASQQRLAGIRAIDTVPVDRLHHGLPVRGMRSVVTLDEAAFGDEGGLYQFGCVLARFLALYASINA
FHELQVVNLRNQERYTWKWQPGQQPLM
 
Nucleotide Sequence: 1764 bp     [Download]
>gi|114319166|ref|NC_008340.1|:51556-53319 Alkalilimnicola ehrlichii MLHE-1 chromosome, complete genome
ATGCTGAACCGCTACTACCGGGACGAACTCAACTTCCTTCGCCAGGAGGGCAGGGCGTTCGCTCAGGCGT
ATCCGCACCTCAGCCGTTTCCTCTCGGAGCCGGGGGACGACCCGGACGTGGAGCGGTTGCTGGAGGGCTT
CGCCTTCCTCACCGGACGCATGCGCGAGAAGGTGGAGGATGAGTTCCCGGAGCTCACCCACTCGCTCATT
AGCATGCTCTGGCCCAACTATCTGCGTCCGGTCCCGAGCATGACCATTGTCCGTTTCGATCCCCGGTGGC
ATGCGTTGCGTGCCGGGCACCGGCTGCCGCGCGGCACCGCGCTGCGGAGCCAGCCGGTACAGGGTACCCC
CTGCCGATTCCGGACCAGTCACGACGTCACCCTGTATCCGTTGGAGGTGGCCGGTGTTGACACCGCCCGT
TCACGCAGCCGGTCCCAGGTGACGTTACGGCTTGCCGTGCACAGTGATCAGCCGCTCGCGGACCTGCCGG
CCGATCCGCTGCGTTTCTATCTTGGCGGTGACGGCTATACGGCGCGCACGCTCTATCTCTGGCTGCAGCA
TTATCTGGAGGGCGTGGATCTGGAGGTGGCCGGCGAGCGTCGCAGCCTGCCGGCGGACGCTATCAGTCCG
GTCGGCTTCGAGCGTGATCAGTCCCTGCTGCCCTACCCGCGCAATAGTTTTCAAGGGTATCGCATCCTCC
AGGAATACCTCTGTGTCCCGGACGCATTCCGTTTCCTTGACTTGCAGCGCTTGTCTGCCGCCCTGCCCCA
CGAGGCGGCCGACGAGATCCGGCTGGTGTTCCGTTTCTCACGCACCCTGCCGAGGGATGCCCGCCTGTCG
GTGGACCACTTCCAGCTCCATTGCACCCCGGCGGTCAACCTCTTCGAGCAGGACGCCGACCCGATTGACC
TGACCGGCGAGCGTGCCGAGTACCCGATCCTGCCCAGTAGCCGTAACCCCGCCCACTACGAGGTCTATAG
TGTCGATGCGGTGGAAGGGTGGCTCACCACGGGCAGCGGCCGGTTCCGCGGCGAGCCCCGCCGTTATGTG
CCCTTCGAGAGCTTCCAGCACCAGCTCGAGCGCGACCGTGGAGGGGATGCGCGCTACTACCGGCTCCGCG
TACGGGAGAGCGTGCGCGACGACGGCTTCGCCCACGATATCGCCTTCGTACGGGAGGACGAGGTCTACCG
GTTGGCGCACCATGAGACCGTCTCCTTGCGCCTGACCTGCACCAACCGGCGGTTGCCCGAATCCCTGGGC
GTGGGTGACATCACCGACTTTGCCGACGACAGCCCCGCCCTGGTCACGGCCCGCAACATCACCCGGCCCA
CCCCTGCCCTCAGGCCGCAACTGGACGGCGGCCTGCTGTGGACGCTGATCTCCAATCTCGCCCTGAACTA
TCTCTCGCTGTTGCATACCGACGCGCTCCGTTCGGTCCTGCGGGCCTACGATTTTCGCGCGTTGGTGGAC
CGTCAGGCCGAGCGCGCCTCGCAGCAACGCCTGGCGGGCATACGGGCCATCGACACCGTGCCGGTGGATC
GTTTGCACCACGGCCTGCCGGTGCGCGGGATGCGCTCGGTGGTAACGTTGGACGAAGCCGCCTTCGGTGA
CGAGGGCGGGCTCTACCAGTTCGGCTGCGTGCTGGCGCGCTTTCTGGCGCTGTACGCCAGCATCAACGCC
TTTCACGAGCTGCAGGTCGTCAATCTCAGAAACCAGGAGCGCTACACATGGAAGTGGCAGCCCGGTCAGC
AACCGCTGATGTGA